(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE12

ASFUM1_4.PE12        Location/Qualifiers
FT   CDS_pept        join(complement(62725..62856),complement(61850..62665))
FT                   /codon_start=1
FT                   /gene_family="HOG000246879" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16273681"
FT                   /orf_name="AFUA_4G00220"
FT                   /product="Metallo-beta-lactamase domain protein "
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL84396.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG054306"
FT                   /db_xref="HOGENOM:HBG324401"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniParc:UPI000051EB2D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W945"
FT                   /transl_table=1
FT                   /translation="MDQYSNLFAFEDYLGAQARSIPDLPEVDVLSPRVVRVLGGNPGQM
FT                   QLQGTNTYILGTGAERLLIDSGQGRARWEQLMASLAAEHKFRISTVLLTHWHLDHTGGV
FT                   PHLFRIFPELRGANAIYKYHPDPSQQAIVDGQVFSVEGATVRAVFTPGHSTDHMCFLLQ
FT                   EEEAIFTGDTVLGHGTTGVEDLEEYMQSLRKIQSLGCRIGYPGHGAVIENMQQKVQQEI
FT                   DRKQRRERQVLLALQNIQREKRTVGDANGAATQAELIEAIFGRLPADVADRFFAPYMKD
FT                   ILMKMARDKQVGFRFKGGQKHWFANVSQENPVCR"
     atggaccaat actccaacct ttttgctttc gaagattacc tcggcgcaca ggccagatcc        60
     attccggacc tcccggaagt cgatgtccta agcccccgag tggtgcgtgt gttgggcgga       120
     aatccgggac agatgcaact tcaagggacc aacacataca ttctgggcac gggagccgaa       180
     cggctgctga tcgatagcgg acagggtcga gcacgctggg agcagctgat ggcatccctt       240
     gcagcagagc acaagttcag aatatccacg gtgttactga cgcattggca tctcgaccat       300
     actggagggg taccgcattt gttccgtatt tttcccgagc tgagaggtgc gaatgcaatc       360
     tacaaatatc atccagaccc cagccagcag gcgattgtcg acggacaggt gttctccgtg       420
     gaaggggcta ctgtgcgcgc tgtattcacg ccgggacact cgacggatca catgtgcttt       480
     cttcttcaag aggaggaggc cattttcacc ggcgatacgg ttctgggtca tggaacgacc       540
     ggtgtggagg atctggagga gtatatgcag agtctgcgta agatccagag tctgggatgc       600
     cgaattggat acccaggaca tggagccgtg atcgagaata tgcagcaaaa ggtgcagcag       660
     gagattgacc gcaagcaacg tcgcgagcgg caagtgctac ttgcgctgca gaatatccaa       720
     cgcgaaaaga gaacagtcgg tgacgccaat ggcgccgcca cgcaggcaga actgatcgaa       780
     gctatttttg gtcgactccc tgcggatgtg gctgatcgat tctttgcgcc gtacatgaaa       840
     gacatcctta tgaagatggc tcgtgataag caagttgggt ttcgcttcaa gggcggccag       900
     aagcactggt tcgccaatgt gagccaagag aatccggttt gtaggtga                    948
//

If you have problems or comments...

PBIL Back to PBIL home page