(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE122

ASFUM1_4.PE122       Location/Qualifiers
FT   CDS_pept        join(complement(362611..362971),complement(362239..362558),
FT                   complement(361058..362185))
FT                   /codon_start=1
FT                   /gene_family="HOG000160714" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19905735"
FT                   /orf_name="AFUA_4G01370"
FT                   /product="Pyoverdine/dityrosine biosynthesis family protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL84283.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG054400"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR007817"
FT                   /db_xref="UniParc:UPI000052009D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9F7"
FT                   /transl_table=1
FT                   /translation="MPYAGNLPTPTENKVSQIISIISAYRHRSAAVPDRFSEFAPALEK
FT                   QLTETVSKGEPVRFILPSFPFKAPAEGDKRKTLGSLPDKAEEIALQTLDAFADSIAEIH
FT                   QPGATVVIVSDASVYGDLLKIPDADAFAYHQELKKLAASLGLTHLEFVRPGTLAGIVPE
FT                   EAKTLEEYSDHVSKTRNLLDGTLAQAVDPNEDENMRATSKHYDTALPQAEDHEAFKAAM
FT                   LKRGKAYAKLIASSAESTIRLSIHESNNVGKITMNLFPPPTSPDFITPWHGAVAVLADA
FT                   SVRIVDASTVDRDRFEVITNHEGRPWLLREKSDLFDWFGMELDFEPLFPCGMQVRPKEG
FT                   YGPYRFEDVNMKLVRRLALSTAPLLLRGFTMQVEKEVFRSKARELGEIQMWPFGDILEV
FT                   RENADFNMNNVLTREAMPFHYDGVFKTVQDEKTGEWISVPPLFQMFRNRAASQSKGGLT
FT                   LFASSRNLIPLLGPDSIPLEELRKLQWETFTAANEAFGGHKLQLPFIITHPESGVDTFR
FT                   FHEPWPESKCVPGSSEPTLVRVVGWPLAESDALCEKLTRLLYDRRVAYRHQWKAGDFIF
FT                   NDNAMTHHTRTAFEDGHREHWRVHVN"
     atgccctacg ctggcaacct tcccactcca acggagaaca aggtctccca gatcatctcc        60
     atcatctcag cctatcgtca ccgctccgcc gctgttcctg atcgcttttc cgagttcgcc       120
     ccagctctcg agaagcaact aacggagact gtctccaagg gggagccagt gcgattcatt       180
     cttccatcct tccccttcaa ggcccccgcg gagggagaca agcgcaagac tctgggctct       240
     ctgccagaca aggcagaaga gatcgcattg caaaccctcg atgcatttgc cgattccatt       300
     gcggagatcc accaacccgg tgccactgtg gtgatcgtct cagatgcgtc tgtatacgga       360
     gaccttctga agattcccga cgccgacgcg tttgcctacc atcaggagct gaagaagctt       420
     gccgcgtctc tcggtctcac tcatttggaa tttgtgcgtc caggcactct tgccggcatt       480
     gtccccgagg aggccaagac actcgaggag tattccgacc acgtctccaa aactcgcaac       540
     cttctcgatg gtaccctcgc ccaggcggtc gacccaaacg aggatgagaa tatgcgagca       600
     accagcaagc actacgacac ggcgctgcct caggccgaag atcacgaagc cttcaaggct       660
     gctatgctca agcggggaaa ggcctatgct aagctgattg cctcatcggc cgagtcgacg       720
     atccgcctgt ccatccacga gtccaacaac gtgggcaaaa tcactatgaa cctcttccct       780
     cctccaacaa gcccggactt catcactccc tggcacggcg ccgtcgcggt cctcgcagac       840
     gccagcgtgc gcattgtcga tgcctccacc gtggacaggg accgatttga ggtcatcacg       900
     aaccacgagg gtcgcccctg gctgctgcgc gagaaatcgg atctcttcga ctggtttggc       960
     atggaactgg attttgagcc tctcttcccc tgcgggatgc aagtccgccc caaggaagga      1020
     tacggtccgt accggttcga ggacgtcaat atgaagctcg tgcgccggct cgccttgtcg      1080
     accgccccgc tccttctgcg cggcttcacc atgcaggtcg aaaaggaggt cttccgcagc      1140
     aaggcgcgcg agctgggcga gatccagatg tggccctttg gcgacattct cgaggtccgc      1200
     gagaacgccg acttcaacat gaacaacgtg ctcacccgcg aagccatgcc cttccactac      1260
     gacggcgtct tcaagaccgt ccaggacgag aagacgggcg agtggatctc cgtgccgccc      1320
     ctcttccaga tgttccgcaa ccgcgccgcg tcccagtcca agggcgggct gacccttttc      1380
     gcctcgtcgc gcaacctcat ccctctcctc ggcccggaca gcatcccact cgaggagctc      1440
     cgcaagctcc agtgggaaac cttcaccgcc gccaatgagg catttggcgg ccataagctc      1500
     cagctgccgt tcatcatcac ccaccccgag tccggcgtcg acactttccg gtttcacgag      1560
     ccttggcccg agagcaagtg cgtgcccgga agcagtgagc cgaccctcgt gcgggttgtg      1620
     ggctggcccc tggcggagag cgatgcgctc tgtgagaagc tgacccggct cctgtatgac      1680
     cgccgggttg cctaccgtca ccagtggaag gcgggggatt tcatcttcaa cgacaacgcc      1740
     atgacccacc acactcgcac agccttcgag gacggccacc gcgagcactg gcgtgtgcat      1800
     gtgaattag                                                              1809
//

If you have problems or comments...

PBIL Back to PBIL home page