(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE124

ASFUM1_4.PE124       Location/Qualifiers
FT   CDS_pept        join(366188..366307,366382..366488,366557..366986,
FT                   367046..367443,367497..368901)
FT                   /codon_start=1
FT                   /gene_family="HOG000178543" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18210312"
FT                   /orf_name="AFUA_4G01392"
FT                   /product="C6 transcription factor, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EBA27171.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0000F51C0A"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA91"
FT                   /transl_table=1
FT                   /translation="MVDATHSTAPVGSDTGVRKFTLSCSRCRASKLKCDRKEPCMECVK
FT                   RNIGHLCTKDERQPRAKRSKIENKDKTPSKRDPPPNGDGEAEAEETAQLLEHFVEGVPR
FT                   PNAYRPAVLGPTPSSVAPDFPNPYWSSNDPKRHGEKLALIREIVDAMPTVEIIDALLEV
FT                   FITRCQGPLGNVVHTPTFLKQAQQFSNCLKLASLDSRVLAVSSTVPMEKLGGYLLALVL
FT                   GLAFHPTPSLLGWTPTPLTLRVEELRASEMHSKTWRSLGLRCLQDGVSLFCGSIASLQA
FT                   AIMLLLDGQENSLALDAVLVTAISGARKLGLHRLGGIKLDASASPVASLENDPAALVEP
FT                   DHIRTEIAIRIWWALVLRDWSRGQALGYYTIHPSQFNTRMPLHINDDDLCPSAWRVTVN
FT                   GEITERPRSEFTMMSYTVHALELAGIVRESIDLRGAPTQQPDGTAESAKLRRHINNKYE
FT                   KYIATLPSYFRLGSTVGLTATGPMAAIPVQRWMLHQQLWSLLLRLHRADLSSPISRASC
FT                   QLLAQNIVSTQAQIQARCAVCGSLSTSETQLFNAAVVLLLDLLFSSKQGDGDSASAHLS
FT                   RLMTRDKIREAIELLRTKSLMEGSSLHDLHLEQVKGSAQRSVVALEALMKLEEGDFDHN
FT                   GTNSSNSAAGNRTREPLAAKDSLRLRITDILRALSGRADPEGAPVQEPQAPMDPLSPFQ
FT                   VSMPFANVPDGFHDLDVLPILSNGLSPNFWQFLDFPPPPFDSHPKEVSLATQGDPPGAF
FT                   GLGPSQFPDSYSSTPSTRMTHTSPSLQSESIGLGGGSDSATTPSSADAYVAAKFYYAMG
FT                   DGTLAPM"
     atggtcgatg caacccacag cacggccccc gtgggctcag acacgggtgt acgcaagttt        60
     acgctctcgt gttctcgatg tcgggcctcg aagctgaaat gcgaccgtaa agaaccttgt       120
     atggagtgcg tcaagcgtaa cattggccat ctgtgtacca aggacgagcg tcaaccgcga       180
     gccaaacgat ccaaaatcga gaataaagac aagaccccct ccaagcgcga tccgccaccg       240
     aatggagatg gcgaggcgga ggccgaggag accgcgcaac tcctagagca tttcgttgaa       300
     ggggttccgc gtcccaatgc ctatcggcct gcggttttgg gcccgacccc gtcgtccgtt       360
     gcgcccgact ttcccaatcc atactggtcg agtaacgacc ccaagcgaca cggggagaaa       420
     ctcgccttaa tccgagagat cgtcgatgcg atgccgacgg tggagatcat cgatgccctt       480
     ttggaagtct ttatcacgcg ttgccagggt ccgttgggga atgtggttca cacgccaacg       540
     ttcctgaagc aagctcaaca gttcagtaat tgcttaaagc ttgcgtcact ggactcgcgg       600
     gtcttggccg tatcgagtac agtgccgatg gagaaactgg gcggttacct cctcgcgctc       660
     gtgcttggtc tcgcgttcca tccgacgccg tctctcctcg ggtggactcc taccccgttg       720
     accctccggg tggaggagct acgagcgtcg gagatgcact ccaagacatg gagatctctc       780
     ggcttgcgtt gcctccagga cggggtgtct ctcttttgtg gctcgatcgc cagtttgcag       840
     gcggccatca tgcttctgct tgacggccag gagaactcat tagcgctgga cgcggttctg       900
     gttacggcca tctcgggagc ccggaaactg ggtctgcacc gcttgggtgg catcaagttg       960
     gatgcctctg catcacccgt cgcatcgtta gaaaacgacc cagcagccct ggtggaaccg      1020
     gaccatattc gaaccgaaat agcgattcgc atttggtggg ccctcgttct gagagattgg      1080
     tcgcgcggac aagcccttgg ctactacacc attcatccat cccagtttaa cactcggatg      1140
     ccgttgcaca tcaatgacga tgatctctgt ccgtccgcat ggcgggtgac ggtcaatggc      1200
     gagatcacgg agcggcctcg gtcagagttc acaatgatgt cgtataccgt ccacgccctc      1260
     gaactcgccg gcattgtgcg cgaatcgatc gatctgaggg gagcaccaac ccagcagccc      1320
     gatggaaccg ctgagtcggc caagctgcgc agacatatca acaataagta cgaaaagtac      1380
     atcgctactc tgccatcata ttttcgactg gggagcaccg tcgggctcac tgccacgggt      1440
     cccatggcag caatcccggt gcaacgctgg atgctgcacc agcaactctg gagcttactg      1500
     cttcgactcc atcgcgcgga tctctcatct ccaattagcc gtgcttcctg tcagcttctc      1560
     gcccagaata ttgtcagtac ccaggctcag attcaggcgc gctgcgcggt gtgtgggtcc      1620
     ctctccacca gtgagacgca actattcaac gcggctgtgg tgttgctcct cgacctgctc      1680
     ttctcatcga agcaagggga cggggacagt gccagtgcac accttagccg attgatgact      1740
     cgggacaaga tccgggaagc aattgaatta ttacgaacca aaagcctcat ggagggctca      1800
     tcacttcacg atctgcactt ggagcaggtc aaagggtctg ctcagcgcag cgtagttgct      1860
     ctggaagcct taatgaagct tgaagaaggt gatttcgatc acaacggcac caatagctca      1920
     aatagtgccg cgggcaatcg tacccgagaa ccattggctg ccaaagactc cctgcggctc      1980
     aggattactg atattctcag ggctctgagc ggaagagccg acccggaggg cgcccccgtg      2040
     caagagccgc aggcccccat ggaccctctt tccccgtttc aggtgtcgat gccgtttgcc      2100
     aatgtccccg atgggtttca tgacctggac gtgctgccga tcctctccaa cggtctcagc      2160
     cccaactttt ggcaattctt ggacttcccc ccgccaccat tcgattctca cccaaaggag      2220
     gtctcgttgg ctacccaggg agacccgcct ggcgcctttg gactgggtcc ttcgcaattt      2280
     cccgactcat atagtagcac tcctagcact cgtatgaccc acacatctcc gtctctgcag      2340
     agtgaatcaa tcggcctggg tggaggcagt gactccgcca caactccctc tagcgctgat      2400
     gcctacgttg ccgccaagtt ttattacgcc atgggtgatg ggacactggc tcctatgtag      2460
//

If you have problems or comments...

PBIL Back to PBIL home page