(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE126

ASFUM1_4.PE126       Location/Qualifiers
FT   CDS_pept        371597..372460
FT                   /codon_start=1
FT                   /gene_family="HOG000178532" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18210313"
FT                   /orf_name="AFUA_4G01410"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84278.1"
FT                   /db_xref="HOGENOM:HBG054365"
FT                   /db_xref="UniParc:UPI000051F9B4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9G2"
FT                   /transl_table=1
FT                   /translation="MQCARSGSSTPMGRDPDARWVQWLALTRRNNHAPLSGAMSPSSSP
FT                   SLPMASSNLNYSSRVHSRSSATSYFALMSAAKDGHQHQHQREEDRKQHYYNGSGTPTRR
FT                   HMDTSWVAWLNEHGHQRCQGGRCPSETPGQLQQPQTCLPDSIVMPSSFLDTPPFTTNTP
FT                   PSMISSSATELPSPLAPLTDAEIDAMSQQFPDFADRFPAEFSDATTAMGPFDPAELDAG
FT                   LLTWLDEQHSFAFHQGEDVAVSPSKRSLTLETYPREMSADGTRREGGIKKQKVYHETYT
FT                   EPGKSA"
     atgcagtgcg cccgtagtgg atcaagcaca cccatgggga gagatccgga tgcgcgatgg        60
     gtgcagtggc ttgctctcac cagacgcaac aaccatgccc cattgtccgg cgcaatgtca       120
     ccgtcctcct cgccctcgct acccatggcg agctccaatc tcaactacag cagccgtgtc       180
     cactcgcgta gcagcgcgac cagctatttt gctctgatgt ccgcggccaa ggacggacac       240
     caacaccagc accagcggga ggaggatcgc aagcagcact actacaatgg cagtggcacg       300
     cccacccgcc ggcacatgga cacctcgtgg gttgcatggc tcaatgaaca cggccaccag       360
     cgatgccaag ggggacggtg cccctcggaa accccagggc aattacaaca accgcaaacc       420
     tgcctcccag acagcatagt catgcccagc tcttttctcg acacgccccc gttcaccact       480
     aataccccgc cctcaatgat ctccagctca gccacggagc ttccctcgcc gctggcgccg       540
     ctcacagatg cagagataga cgccatgagc cagcaattcc cggactttgc ggaccgtttc       600
     cccgcggagt tttccgacgc aacgaccgcc atggggccgt ttgatccggc cgagctagat       660
     gccggcctgc tgacctggct cgacgaacag cattcgttcg cgttccatca gggcgaggac       720
     gtggccgtta gtccgagcaa gcggagtttg acactggaga cgtatccgcg cgaaatgtcc       780
     gcggacggaa cgagacggga ggggggaatc aagaaacaga aggtatatca tgaaacttat       840
     accgagccgg ggaaaagtgc ttga                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page