(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE128

ASFUM1_4.PE128       Location/Qualifiers
FT   CDS_pept        join(374980..375107,375158..375326)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274686"
FT                   /orf_name="AFUA_4G01430"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84276.1"
FT                   /db_xref="HOGENOM:HBG054353"
FT                   /db_xref="UniParc:UPI000051F25A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9G4"
FT                   /transl_table=1
FT                   /translation="MYVQHTGLRPSSTNHWRYSTHGIRPPRKGLAPKHRRTSLRPSRRT
FT                   GSQRWSRWRLIEARSVAPTCKRGDYIDYIATAWIGWITVTVVRGFRLPWVKTQ"
     atgtacgtcc agcacactgg gctgagaccc tcaagtacca accactggag gtattctacc        60
     cacggtatcc gtcctccgcg gaagggcctt gcccctaagc accgcaggac gtctttgcgt       120
     ccttcaagac gcactggtag tcagcgctgg tctcgatggc gactcataga agccagaagc       180
     gttgcaccaa cctgcaaacg cggagattac attgattaca ttgcaactgc ctggattggc       240
     tggatcacgg ttactgtcgt ccgcggtttc cgtctgccat gggtaaagac tcagtag          297
//

If you have problems or comments...

PBIL Back to PBIL home page