(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE13

ASFUM1_4.PE13        Location/Qualifiers
FT   CDS_pept        join(63169..63229,63311..63795)
FT                   /codon_start=1
FT                   /gene_family="HOG000189880" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18210055"
FT                   /orf_name="AFUA_4G00225"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27176.1"
FT                   /db_xref="InterPro:IPR013901"
FT                   /db_xref="UniParc:UPI0000F51BBD"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA85"
FT                   /transl_table=1
FT                   /translation="MASVQGLIKIVAITGGVWLSGKITAHSLVSVPALLQTRSADGLSP
FT                   CTILRVWRRIYEQGHRHSPQIAACTSTAFAYLAWCASDRTPRLLYGTAACSVMGIVPYT
FT                   LLFMGPTNSRLLERSAAEEEKVPGATRGEDMVNVPSEMTTEELLSHWRFLAGIRGLLPL
FT                   AGGILGLFAALYSNEGAR"
     atggcatccg ttcagggcct aatcaaaatc gtcgcaatca ctggcggtgt gtggttatcc        60
     ggaaaaatta cagcacacag cctggtctct gtgcctgctc ttcttcaaac caggtcggca       120
     gatggtctct ccccctgcac gattctccga gtatggcgac gaatctatga gcagggacac       180
     agacatagcc cgcagattgc cgcgtgtacc tcaacagcct ttgcctacct agcatggtgt       240
     gcttccgatc gcacgccgag gctgctgtac ggcaccgctg cgtgttcagt catggggatt       300
     gtgccctata cactcttgtt catgggcccg accaattctc ggctgctcga acgatcggca       360
     gcagaggagg aaaaggtccc gggcgccact cggggggagg atatggtgaa tgtacctagt       420
     gaaatgacta cggaggagct gctcagtcac tggaggtttc tggccgggat tcggggcttg       480
     ttgccactag ctggagggat tcttggcttg ttcgcagcat tatattcgaa cgagggagct       540
     cgctag                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page