(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE130

ASFUM1_4.PE130       Location/Qualifiers
FT   CDS_pept        join(complement(378920..378960),complement(378444..378870),
FT                   complement(378126..378384),complement(377634..378073))
FT                   /codon_start=1
FT                   /gene_family="HOG000220501" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18210314"
FT                   /orf_name="AFUA_4G01450"
FT                   /product="Phospho-2-dehydro-3-deoxyheptonate aldolase "
FT                   /EC_number="2.5.1.54"
FT                   /function="3-deoxy-7-phosphoheptulonate synthase activity "
FT                   /biological_process="aromatic amino acid family
FT                   biosynthetic process"
FT                   /protein_id="EAL84274.1"
FT                   /db_xref="GO:0003849"
FT                   /db_xref="GO:0009073"
FT                   /db_xref="HOGENOM:HBG054336"
FT                   /db_xref="HOGENOM:HBG670536"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000052009C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9G6"
FT                   /transl_table=1
FT                   /translation="MLATPGVISRGPEVPHTRPHLLAGSIVPEPSSPLKDSNVAAYEPL
FT                   IPPALLLHEFPVTPASRRTIESARQGAARIIQRNGDDRLLVIVGPCSIHDTDVARDYAV
FT                   RLQAAIQEHGWDKDLLIVMRAYLEKPRTTVGWKGFLYDPNIDSTNQVNMGLKVARKLLL
FT                   DITALGLPVACEVLDTISPQFLADLYSWGAVGARTTESQVHRQLVSGLSFPIGFKNGSS
FT                   GNITNACDAMKSASSPHSFLGVTEQGLAAIVHTKGNPHLHVIHRGGDSGPNFDAASVAS
FT                   TIKAYPKNLQPSIMIDASHGNSQKDYRNQPKVIDAVASQIAAGEPAITGVMIESNINEG
FT                   KQAAPQSEDEVQKLKYGVSITDGCVGFETTVKMLETLSQVRETVLYKD"
     atgttggcca cacccggagt catcagccga ggaccggaag tcccgcacac tcgccctcat        60
     ctcctcgccg gtagcattgt gcctgagccc tcgtcccctc ttaaagacag caatgttgca       120
     gcctatgagc ctctcattcc gcctgcactt ctgcttcacg agtttcccgt caccccggcc       180
     tctcgacgca cgatcgagtc agcccgacag ggagcagcgc ggatcatcca acggaacggc       240
     gacgaccggt tactggtcat cgtggggccc tgctccatac atgataccga cgtggcacgc       300
     gactacgctg tccgcctgca ggccgccatt caggagcacg gatgggacaa ggatcttctg       360
     atcgtcatgc gtgcctacct tgaaaaaccg cggactacgg tgggctggaa aggctttctc       420
     tacgatccga atatcgactc caccaaccag gtcaacatgg gattgaaggt tgcccgtaaa       480
     ttgctgctcg acatcactgc tctcggtctc cctgtggcct gcgaggtgct cgacaccatc       540
     tctccgcagt ttctggccga tctgtactcc tggggtgcag taggggcgcg cacgacagag       600
     tcgcaggtcc accggcagtt agtctcgggc ctgtcatttc ccattggctt taagaatggg       660
     tcctcgggta atatcaccaa cgcatgcgat gcgatgaaga gcgcctcctc tcctcactca       720
     ttcttaggtg tcaccgaaca aggtcttgca gccatcgtcc acacgaaagg aaatcctcat       780
     cttcacgtta tccaccgtgg aggagacagc ggccccaact tcgacgctgc gtctgtcgcg       840
     tccacaatca aggcttaccc gaagaatctc caaccgagta tcatgatcga tgcgtcgcac       900
     ggcaacagcc aaaaggatta ccgtaaccag cccaaggtga tcgatgcagt tgcctcccag       960
     atcgctgctg gggagcctgc cattaccgga gtcatgattg agagtaatat caacgagggt      1020
     aagcaggctg cgccacagtc ggaggacgag gtgcagaagc tcaagtatgg tgtctccatc      1080
     acggatggat gtgttggttt tgagactaca gtgaagatgc tcgagacgct cagccaggta      1140
     cgtgagacag tcctctacaa agattga                                          1167
//

If you have problems or comments...

PBIL Back to PBIL home page