(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE131

ASFUM1_4.PE131       Location/Qualifiers
FT   CDS_pept        379597..381765
FT                   /codon_start=1
FT                   /gene_family="HOG000178509" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19905736"
FT                   /orf_name="AFUA_4G01460"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84273.1"
FT                   /db_xref="HOGENOM:HBG054327"
FT                   /db_xref="InterPro:IPR006905"
FT                   /db_xref="UniParc:UPI000051EFED"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9G7"
FT                   /transl_table=1
FT                   /translation="MTSHHPAANNPSPTSRVQSSVIQSSLTSVTTKMTVTKPTPKHTFA
FT                   ERAAANNLNDAQILNSNNPAGADIPEKSDVVVAGGGIHGLIYAIHAAKYKPGKLNISLI
FT                   EKGTKPGYKIGESTLPLFSLWCKMHGLTAEYMLRLFGLKDGLCFYFLDRENQGHYTDFC
FT                   SNGTPGLFLSGFQIERPISELLFTLLAQRSGVNVFHGRQVDFNGSTIRGGFQNNRVAIN
FT                   PGKFDGKPATTIDSSLLVDATGRFRQLASKKASLHRFEGWNYDAFWGYFTAPKDESNIP
FT                   FRYYEGDHTNHLCFPEGWAWVIRLPSWEGSPIPNLMDMISYLLDCAEAGVPGDQIPSSE
FT                   ELAKMFDLKFRWVTSIGFAVRNDVKYPEDMSAYGTREAERKFNYFVEKYDLIKKFMSNF
FT                   ELVENLYGPGTTWYIRKSLTYQSPVVSGPGWLAVGDACGFTNPLHSPGITAAMSTSTYA
FT                   AELTHTALEEAQRAADAEAAELSIRKTLAPYDDFAKRLIPALNQMNKFNYVCFREPRLG
FT                   PQVSCLWQFFAGIGIPGWQLIRQDYNLNFETYVPHSINWAWGSMVPEYDAVARKAIELI
FT                   APIPLEGSVPDATVREVIEFSNSVKRVAVDSNRFNFRWDGLLRYYDIFLNYDEKKNWKD
FT                   VFSRQCKGCGAWLVCRPDWRKCYSCGKERTEEEAAITWNPPLAVDEVKALVRASDAKPA
FT                   SRAAKEGAVQEQLKDRTVVVSHAVEITV"
     atgacctctc atcatcccgc agcaaacaac ccatctccaa catctcgagt tcagtcgtct        60
     gttattcagt caagtttaac atctgtcact accaaaatga ctgtgaccaa gcccacccct       120
     aagcacacct ttgctgagcg tgctgccgcc aacaatctca acgatgcaca aatcctcaac       180
     tccaacaacc cggcaggtgc agacatccct gagaaatccg acgttgttgt cgctggtggt       240
     ggtatccatg gcctcatcta cgcgattcac gctgccaagt acaagccagg caagctcaac       300
     atctccctga tcgagaaggg caccaagcca ggctacaaga ttggggagag cacgctccct       360
     ctcttctccc tgtggtgcaa gatgcacggc ttgaccgccg agtacatgct gcggctcttc       420
     ggcctcaagg atggactctg cttctatttc ctcgaccgtg aaaaccaggg ccactacacc       480
     gacttctgca gcaatggtac ccccggtctc ttcctcagcg gtttccaaat cgagcgtccc       540
     atcagcgagc tgctcttcac tctgctggcc cagcgcagtg gcgtcaatgt cttccacggc       600
     cgccaggtcg acttcaacgg cagcaccatc cggggcggat tccagaacaa cagggttgcc       660
     atcaaccccg gaaagttcga cggcaagcct gccacaacca tcgattcctc ccttctcgtc       720
     gatgccaccg gtcgcttccg ccagttggct tccaagaaag cctccctcca ccgttttgaa       780
     ggctggaact acgacgcctt ctggggctac ttcacggccc ccaaggatga aagcaacatt       840
     cccttccgct actacgaggg tgaccacacc aaccatctgt gcttccccga gggctgggcc       900
     tgggtcatcc gtctcccctc ctgggagggc agccccatcc ccaacttgat ggacatgatc       960
     tcgtacctgc tcgactgcgc cgaggctggt gtccccggcg accagatccc cagctccgag      1020
     gagctcgcca agatgtttga ccttaagttc cggtgggtta ccagcatcgg gttcgccgtc      1080
     cgcaacgatg tcaagtaccc agaggacatg tccgcgtacg gcacccgtga ggcggagcgc      1140
     aagttcaact actttgttga aaagtatgac ctcatcaaga agttcatgag caacttcgag      1200
     ctcgttgaga atctctatgg accgggaacg acgtggtaca tccgcaagtc tcttacctac      1260
     caatccccgg tcgtctcggg ccctggctgg cttgctgtcg gcgacgcctg tggcttcacc      1320
     aacccgctgc actcccccgg tatcactgcg gccatgtcga cctcgaccta cgcagccgag      1380
     ctgacgcaca cggcgctcga ggaggctcag cgtgccgcgg acgcagaagc agccgagctc      1440
     tccatccgca agacgctcgc tccctacgac gacttcgcca agcgcctcat ccccgccctg      1500
     aaccagatga acaagttcaa ctacgtctgc ttccgtgaac cccggctggg acctcaggtc      1560
     tcctgcctgt ggcagttctt tgcgggcatc ggtatccccg gctggcaact cattcgccag      1620
     gactacaacc tcaatttcga gacttacgtg ccccactcga ttaactgggc ctgggggtcg      1680
     atggtgcccg agtacgatgc cgtcgcccgg aaggcgatcg agctcattgc cccgatcccg      1740
     ctggagggga gcgtccccga tgcgaccgtc cgcgaagtaa tcgagttctc gaactcagtc      1800
     aagcgcgtcg cggtcgactc gaaccggttc aatttccgct gggacggtct cctgcgctac      1860
     tatgatatct tcctcaacta tgatgagaag aagaactgga aggatgtgtt ctcgcggcag      1920
     tgcaaggggt gcggagcctg gcttgtctgt cgccctgact ggcgcaaatg ctactcctgc      1980
     ggcaaggaga ggaccgaaga ggaggcggcc atcacctgga acccgcctct ggccgtcgac      2040
     gaggtcaaag ccctggtgcg ggcatcagat gccaaacctg cttcccgggc ggccaaggaa      2100
     ggggctgtcc aggagcagct caaggacagg acggtggttg tttcgcatgc ggtggagatt      2160
     actgtatag                                                              2169
//

If you have problems or comments...

PBIL Back to PBIL home page