(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE136

ASFUM1_4.PE136       Location/Qualifiers
FT   CDS_pept        join(complement(398776..398850),complement(398582..398682),
FT                   complement(398252..398511),complement(397720..398220),
FT                   complement(397469..397661),complement(397261..397365),
FT                   complement(396691..397181),complement(396406..396615),
FT                   complement(396214..396350))
FT                   /codon_start=1
FT                   /gene_family="HOG000048696" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274690"
FT                   /orf_name="AFUA_4G01510"
FT                   /product="C6 transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL84268.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG054104"
FT                   /db_xref="HOGENOM:HBG324847"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000051F74B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9H2"
FT                   /transl_table=1
FT                   /translation="METPSDQLSLQGPPGKRRRVALACDCDGIRPQCSMCKDLGFECAY
FT                   TPPVTATNVIVQKDYLKDLESRVKSLEENLTTVQSNLSGLAAQITGRSPPSEGPPEPCQ
FT                   EPLADLAESEDPIDAMGAVTFADEEDCGYFGEDDSSPVCPTRPSSNIAFLRHLSRAVSH
FT                   RKISQKEINTPLIDQTAYDGGVVSATRPPSPLSGCTPTSGQPGLVTNLALPSSEETLQL
FT                   IRRYFYETGLLFPYIHPPTFLEAYDEFKNNAKKVRRTWLGLLSIMLAMAKVTAVSGHAP
FT                   AESRIKESTVYYRQALNLCRGEMLRGTTLEVVQYLLLMGQYLQGTQKSVQAWTVHGLAV
FT                   KAALQLGLHSKDASQAFSPLERETRKRIWFGCVVLDRYVQLDLPVVDSVGEGEPFVDDK
FT                   TIRHSIQFFNSTITLYKQMGSIIDQVYGQNLGCGSGPSVGETVGRVLLIENQLFSWVMA
FT                   LPENLRLLTLQGLHEEISKSENQPGPFFSLKFRVILTLRYLHTQILLHRPILVKFLDAS
FT                   LPSGLEPGQERILNEIGHSSMNKCVESAMGIIDIIHELVFATGRQRDLLGAWWYSLYYT
FT                   FNAALVIIGATWVQRARQSAHDSPVHQSTNIQPYPSRAVATLYRLDTGNRMVDRCRYYL
FT                   EQLISVLHLQPDDLAGTAISSVTPGFDFLSFGMECGEFMLDDFFTNITHASVLER"
     atggagacgc cgtctgatca gctctctctt cagggaccac ccgggaaacg tcgccgcgtg        60
     gccctggctt gcgattgtga tggcatccgg ccgcagtgca gcatgtgcaa agacctgggg       120
     ttcgaatgtg cctatacccc gccagtcacg gccacaaatg tgatcgtgca gaaggactac       180
     ctcaaagacc tcgagtcccg ggtgaagtcg ctggaggaaa acctcaccac cgtgcaatca       240
     aacctgtcgg gactggcggc acaaataacc ggcagaagcc cgccgagcga aggtccgccg       300
     gagccttgcc aagagcccct agccgacctg gcagagtctg aggatcccat tgacgccatg       360
     ggtgcagtaa ccttcgcgga tgaggaggat tgcgggtatt tcggtgaaga cgattcatct       420
     cccgtctgtc caacgcgccc atcctcgaat atcgcctttt tgcggcacct gtcccgcgca       480
     gtgtctcacc gcaaaattag ccaaaaggaa atcaatacgc ccctgatcga ccaaactgcc       540
     tatgatggcg gcgtcgtcag cgccactcgg ccgccatcac cgttgtcggg ctgcacaccc       600
     acatccgggc agcccgggct cgtgacaaat cttgccttgc catcgtccga ggagacttta       660
     cagctgattc gccggtattt ttatgagacg ggattgctgt tcccgtacat ccaccccccg       720
     acctttcttg aggcatatga cgaattcaag aacaatgcca agaaagtccg ccgaacctgg       780
     ttaggcctac tgagcatcat gctggccatg gcgaaggtga ccgccgtgtc cggccatgcc       840
     ccggcggaat cacggatcaa agagtccacc gtctactatc gacaggcatt gaacctgtgc       900
     cggggcgaga tgctccgagg gacgactctg gaagtcgtgc agtatctcct actcatgggc       960
     caatatctcc aagggacaca gaaatccgtc caggcgtgga ctgtacacgg actggccgtc      1020
     aaggccgcgc tgcagctcgg gctacattcg aaggatgcct cccaggcgtt ctcccctctt      1080
     gaacgtgaga cacggaaaag aatatggttt ggctgtgtgg ttctggatcg ttatgttcag      1140
     ctggacctcc ccgtcgtcga tagtgtcggt gagggcgaac cgtttgtcga cgacaagacc      1200
     atccgtcata gcatccaatt ttttaatagc accataaccc tctacaaaca aatgggcagc      1260
     atcatcgacc aagtctacgg ccaaaatctg ggctgtggct ctggcccgtc tgttggtgag      1320
     actgtgggcc gggtgctgtt gattgaaaat cagttgttct catgggtcat ggcgcttccg      1380
     gagaaccttc gcctgttaac actgcagggg ctgcatgagg aaatcagcaa gtcggagaac      1440
     cagccaggac cttttttctc cctgaagttt cgggtcatcc tcaccctgcg ctatcttcac      1500
     acccagatcc tgctgcatcg gcccatcctg gtcaagtttc tcgacgcgag cctcccgtct      1560
     ggcctggagc ctggccagga gcggattctg aatgagatcg gccatagtag catgaacaag      1620
     tgcgtcgaat cggccatggg aattatcgac ataatccacg aactggtctt tgcaacaggg      1680
     cggcagcgcg atctcctagg ggcgtggtgg tactctctgt attatacctt caacgcggca      1740
     ctggttatta ttggggccac ctgggttcag cgcgcaaggc agtcggccca tgattccccg      1800
     gtgcaccagt ccaccaatat ccaaccctat cctagtcgcg ctgtcgcaac tctgtatcga      1860
     ctggatacgg gtaatcgcat ggtggaccgc tgcagatatt atcttgagca gttgatctcc      1920
     gtcctccatt tacagccaga tgacctggct ggtactgcca ttagcagcgt gaccccgggc      1980
     tttgactttt tgtcttttgg catggagtgt ggagaattta tgttggatga cttctttaca      2040
     aatatcacgc acgcatcggt gttggaacgt tga                                   2073
//

If you have problems or comments...

PBIL Back to PBIL home page