(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE140

ASFUM1_4.PE140       Location/Qualifiers
FT   CDS_pept        join(415070..416049,416102..416369,416417..416755,
FT                   416805..417140)
FT                   /codon_start=1
FT                   /gene_family="HOG000158970" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16274693"
FT                   /orf_name="AFUA_4G01560"
FT                   /product="MFS myo-inositol transporter, putative "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL84263.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG054723"
FT                   /db_xref="HOGENOM:HBG324208"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051F4D5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9H7"
FT                   /transl_table=1
FT                   /translation="MVEKSSDPEVPSLSHHESSISIEKQGDAATAREWAQDVNSTTTNT
FT                   KLKNPLAGLTREQLLNDVEAFAKEKDLEHILDDLRKGALVAQDPREFEQMDALTESEKE
FT                   LLRREKTHRWSQPFMMYFMTSESSRYPPTEFGFNPACQSSVLDLLSCREWIRLLSTVRR
FT                   SMYSSITHLSYAKQSRFYFAEFNVTDTWMQGLLNGAPYLCSAVIGCWTTAPLNRWFGRR
FT                   GCIFISCFISFASSFWMAAAHTWWNLLLGRFLLGFAVGAKSTTTPVYGAECSPANIRGA
FT                   LVMMWQMWTAFGIMLGYIASVAFMDVTHPTIPGFNWRLMLGSTAIPPFFVCIQVYFCPE
FT                   SPRWYMMRNRYHDAYKALCKFRPSTFQAARDLYYIHAALKVEEKLREGKHLFREMFTIP
FT                   RNRRAAQSSFFVMFMQQFCGVNAIMYYSSSMFREAGFDTRMALITSLGCGITNWIFALP
FT                   AVYTIDTFGRRNLLLTTFPLMCIFLLFTGFSFYIPDQTSRTACVATGIYLFMIVYSPGE
FT                   GPVPFTYSAEAFPLYIRDIGMSFATATTWGFNFIVSLTWPSLNKSFTPTGAFGWYAAWN
FT                   FFGWIFCYFCLPETKALSLEELDQVFSVPTTKHVNHYRAMLPWYVKKYLLRRDVPPQNQ
FT                   LYDYY"
     atggtggaga agagttccga tccagaggtc ccaagtctct ctcaccatga gtcttctata        60
     tctattgaga agcaaggaga tgcagctact gctcgagagt gggctcagga tgtgaacagc       120
     accacgacca acactaaact caagaatcct cttgccgggt tgactcgaga acagctcctg       180
     aatgacgtcg aggctttcgc gaaggagaaa gatctcgagc atatcctcga cgatctgcgc       240
     aaaggagctc ttgtcgcaca ggacccaaga gaattcgagc agatggacgc gctgacagag       300
     agtgagaaag aacttcttcg aagagagaag acgcatcgat ggagtcagcc gtttatgatg       360
     tattttatga ccagtgagtc ttctcggtat cctcctactg aatttggatt taacccagcc       420
     tgtcagtcct ctgtgctgga tctgctatcg tgcagggaat ggatcagact gctgtcaacg       480
     gtgcgcagga gtatgtactc tagcattact catctgagct atgctaagca gagcaggttc       540
     tactttgctg agtttaatgt caccgacact tggatgcaag gcctcctcaa cggcgctccc       600
     tatctctgct cggccgtcat cggatgctgg accactgcac ccctgaatcg ctggtttggt       660
     cgccgcggat gcattttcat ctcctgcttt atctcctttg cctcgtcgtt ctggatggcg       720
     gccgcgcata cctggtggaa tttgttgctt ggccgtttcc ttctcggttt tgccgtgggc       780
     gccaaatcca caaccacccc tgtgtatggt gcggagtgct cgccggctaa tatccgcggt       840
     gccttggtca tgatgtggca gatgtggacg gcatttggta ttatgctggg atatattgcc       900
     tctgttgcgt ttatggatgt gacgcatccc acaatcccgg gcttcaactg gcgattgatg       960
     ctggggtcga ccgcgatccc tcccttcttt gtctgcatcc aagtctactt ttgtcccgag      1020
     tcgccgaggt ggtatatgat gcgcaaccgc taccacgacg cgtacaaggc gctttgtaaa      1080
     ttccgcccgt ctacgttcca agccgcgaga gacttgtact atattcatgc cgcattaaag      1140
     gtggaggaga agctccgcga gggcaagcat ttgttccgcg agatgttcac tatcccacgc      1200
     aaccgacgtg cggcgcaatc gtctttcttt gttatgttca tgcagcagtt ctgcggtgtt      1260
     aatgcaatta tgtactattc ctcgtcgatg tttcgggaag ccgggtttga cacccgtatg      1320
     gcacttatca cttctctcgg gtgcggcatc accaactgga tctttgccct gcccgccgta      1380
     tacacaattg acacctttgg acgacgaaat ctgctattga ccacattccc cctgatgtgt      1440
     atattcctcc tcttcaccgg cttctccttc tacattcccg atcaaacgtc tcggactgcc      1500
     tgcgtcgcga ctggcatata cctcttcatg atcgtatact cgcccggtga aggcccggta      1560
     ccattcacct actctgcaga agctttcccc ctctacattc gagacatcgg catgtccttc      1620
     gcaacagcca caacgtgggg tttcaacttc attgtctcgc tgacctggcc gtcgctgaat      1680
     aaatcattca cgcccaccgg tgcctttggc tggtacgcgg cgtggaactt ctttggctgg      1740
     atcttttgtt atttctgtct gccggagacc aaggcgctct cactggagga gctggatcag      1800
     gtcttttccg ttccgacgac aaagcacgtc aatcactatc gggcgatgtt gccatggtat      1860
     gtcaaaaagt atctgcttcg gagagatgtt ccgccacaga atcagctcta cgattattat      1920
     tag                                                                    1923
//

If you have problems or comments...

PBIL Back to PBIL home page