(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE142

ASFUM1_4.PE142       Location/Qualifiers
FT   CDS_pept        join(complement(426335..427264),complement(426054..426287),
FT                   complement(425681..426002),complement(423876..425634),
FT                   complement(422831..423840),complement(421735..422771))
FT                   /codon_start=1
FT                   /gene_family="HOG000199956" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274694"
FT                   /orf_name="AFUA_4G01580"
FT                   /product="Ankyrin repeat protein"
FT                   /protein_id="EAL84261.1"
FT                   /db_xref="HOGENOM:HBG054502"
FT                   /db_xref="HOGENOM:HBG324435"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000051F4D2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9H9"
FT                   /transl_table=1
FT                   /translation="MADSYTLPAVPAKHSTFIDYINSRPHESIPDLVRAYNEYDAVLRK
FT                   IYAQQPSHPAIANKLINLVPLFDGSGSADLRIRARDLASEPEELKAKYLMPLKDEDRKA
FT                   HGSPAVVSSFKQFQTNFNLFSESALSDLDWSNVVAAGSAVTTSLLPVPEEYRDSKRGLR
FT                   EYYHQKFAPASDVDLFLYGLTEEQAIEKIKQIETRIKDSILAETSTIRTKNAITIVSQY
FT                   PTRHVQIVLRIYKSIAEILTGFDVDCSCAAYDGSQVYLAPRAVGAFVTQINHVDLSRRS
FT                   PSYENRLSKYARRGFEVFWPLLDRTRIDPTIFERSFTRTRGLARLLVLEKLPKPSDRDA
FT                   YIDKRRRERGRPVPMRISKQLRGNIKNDWDDEVPEWVDEEDVSDYHTFTIPYGERFHAR
FT                   KIEKLLYTKDLLLNAEWNKPKDREVNLHRHPAFFGNFEDVIEDCCGFCPVPITPDEKEL
FT                   AEEESKIYVSGRIKFLQDNPGRQEIGSFNPITETDWTDMAYVGNTAGLCQAIVDNDVEG
FT                   VKQWLSPDFDVNRRDFTGRTPLHLAVMTSTPEIVQCLVDHGARLVARLADGRTALHLAA
FT                   ARGHVEIIRILLTKSEENEDEEARKEQARKGVSSGKEAHDGEEDAELIQHPSAESEADA
FT                   QSFATDSFVKVHKDANSAQDSVPDDSSDQDPDVYDINVIAWDSHASPLHLAILNGHIAA
FT                   VEELVSSFGADVLLPVKLLHEYNNSPRAAILTLVLALQLPIEQAKAMTTKLLQLGASPA
FT                   QADLDQKTAVAHIAALPKYTELLDSYLQHDRPAVERALNYIATSGWQFSPNAETALKTA
FT                   IKSGNVIGALKLLDAGASPTIAFDEFIKSAQVHIDGIRNNSSEQVKRRFDASVTQPIIL
FT                   SVLKDQPSVAPKLLARGADPNTLTKEGHQIQHEVHARAYRHGKSLLDCVREKLNALRAY
FT                   EPETDSPEPPRPLEHEDSYYLSPFREDTYQLWTAKAALRSAHSSLESEQKRYDDDVKCA
FT                   ANRKGVDEKKAAVQLTLGEFEKLEEELLARGAKEFKQLFPDIRTPSDNDGNHYGSCATK
FT                   SESFRVTFDFRRPDLNDITREGYIQLSVLLRFLPFEAAWCGDLETIKSLTLGTWGPDKQ
FT                   RPPLEIATKDQRNFHPFNIAVLRGHLDVAKAILAIAQVQYKPQDEQANVRYRLRATTNH
FT                   DDGCSSDDEGDEDDNDNSDGLDIERQILDEKFTIDNIGEVKTQVESRTPPLSLLEDCCS
FT                   AEDFIETSLPEDRKPYNLVQYAICKDDVRLLVFLLDLGRELSAKSGSSEQTIFTVGQRD
FT                   LTVAMQLGRVRCLAELIKRTGAGIQLDKLAEQSGVEIKEKPKYYQGLSIHGKKRADWAA
FT                   AGRGILPVQPEEGKPPLLVAAREGNLETVEWFLGTAPGRYYMEFTECHQRDKRVKRLTM
FT                   GKLGVERSITNWLNRRRDLVLHCALFAKPTAESERLVKYLVQHVPHCLEVKSVDGYTPL
FT                   MIAFSLVRPTYAKILIKAGADQTVRDKKGCNILHHLFCGVSSPSVERLDDFQKMLGLVD
FT                   PSLVSSLLVERSSHGPGSLTPLAMWMMRALNTTNTYSVYGNGSNYEGDNQMETLRIILD
FT                   FAQSTGQKHLELLNGAGNSIMHDAVRCQLLKTLEILFERRPDLLHRENASGLTPAEVAE
FT                   ASWVTEVTSNPPGWERRYRFTYSSQYGESLVDRRPESFVEEGDEAPTMKRRIYDFCRSK
FT                   AETLREPDAKRRLVTLFEANEVARRLVAKDLQENQNFGGAARRRRWDKHDEREFGDEVR
FT                   EWLPEVF"
     atggccgaca gttacaccct ccctgccgtc cccgcgaagc actccacctt catcgactac        60
     atcaactctc gtcctcatga gtcaatcccg gatcttgtac gggcctacaa cgagtacgat       120
     gcagtccttc gcaagatcta cgcccaacaa ccatcccacc ccgcgattgc aaacaaactc       180
     attaatctgg tgccgctgtt cgatggcagt ggctcagcgg atcttcggat tcgcgcacgt       240
     gatctggctt cagagccgga ggagctcaag gccaagtatt tgatgccact aaaggatgag       300
     gatcgaaaag cgcatgggtc cccagccgtg gtatcctcct tcaaacagtt ccagacgaac       360
     ttcaacctgt tctctgagag cgccctcagt gatctcgact ggagcaatgt ggtggccgcg       420
     ggaagtgcag tgaccacctc tttattaccc gttccggagg agtaccgcga ctcgaaacgc       480
     ggcctgcgtg aatactacca tcagaaattt gctcctgcct cggatgtcga tctgtttttg       540
     tatgggttga ccgaggaaca ggccattgag aagatcaagc agatcgaaac ccgcatcaaa       600
     gactcgatcc tggccgagac ttccaccatt cgcacaaaga atgccatcac gatcgtgtcg       660
     cagtacccca cccgccatgt tcagatcgtc cttcggattt acaagtccat cgccgagatc       720
     ttgaccgggt ttgatgtcga ctgctcgtgc gcagcctatg atggttccca ggtgtatctg       780
     gcaccacgtg ccgtcggcgc gtttgtcacc caaatcaacc atgtggatct gtccagacgg       840
     tccccgtcgt atgagaatcg tctatccaaa tacgctcgcc gaggatttga agtgttctgg       900
     ccactgttgg accgcaccag gattgatccg acgatttttg agcgcagctt cacccggacg       960
     cgaggccttg cccggctttt ggtgttggag aagctcccga agccttctga ccgggatgca      1020
     tacatcgaca agcgacgtcg agagcgaggc cgaccggtcc ctatgcgaat ctcgaagcag      1080
     ctacgaggaa acatcaagaa tgactgggac gacgaggtgc ctgaatgggt cgatgaggag      1140
     gatgtgtccg actaccatac gtttaccatt ccttatggcg aaagattcca cgctcgaaag      1200
     attgagaaat tactctacac taaggatttg ctgctcaatg cggaatggaa caaacccaaa      1260
     gaccgcgagg tcaacctgca tcggcatccg gctttcttcg gcaattttga ggatgtgatc      1320
     gaggactgct gtggcttttg tcctgttccc atcactccgg acgagaagga actggccgag      1380
     gaggagagca aaatttacgt ctccggcaga atcaaattcc tccaggacaa ccccggccgc      1440
     caggagattg gcagtttcaa ccctatcacc gaaaccgatt ggactgacat ggcatacgtc      1500
     ggaaacacag caggcctgtg tcaggcgatc gtcgacaacg acgtggaagg cgtgaagcag      1560
     tggctctcgc ccgactttga tgtgaaccgt cgcgacttta ccggtcgcac tccgttgcat      1620
     ctggcagtca tgacctccac acccgaaatc gttcagtgtc ttgttgacca cggagctcgt      1680
     ttggtcgctc gactggccga cgggcgaacg gccttacatc tcgctgcggc tcgaggtcac      1740
     gtcgagataa tcaggatctt gctgacgaag agcgaggaga atgaggatga agaagctcgc      1800
     aaagagcagg cgcgcaaggg agtctcatcc ggtaaagagg cccacgatgg tgaggaagat      1860
     gcggaactca tccagcatcc ttccgctgag agcgaggcag atgctcagtc gtttgccacc      1920
     gattcgtttg tcaaagtcca caaggatgca aatagcgcgc aggactcggt gcccgatgac      1980
     tccagcgacc aggaccctga tgtctatgac atcaatgtga ttgcttggga tagtcacgcc      2040
     tcccctctgc atctcgcgat tttgaatggg cacatcgctg cggttgagga actggtatcc      2100
     tctttcggcg cggatgtgct tctgccggtc aaattgttgc acgagtacaa caacagcccg      2160
     cgagctgcca tcctcactct ggtcttggct ctccaactgc caatagagca ggcgaaggcg      2220
     atgaccacga agctgctaca actgggtgcc tcgccagcac aggcagatct ggaccagaag      2280
     actgccgtgg ctcacattgc ggcgcttccg aaatacactg agttgctgga ctcgtacctg      2340
     cagcatgacc gtccggcagt cgaacgggca ctcaactaca ttgctactag tggttggcaa      2400
     ttcagcccca atgcagagac ggcgctgaaa acggcgatca aatcgggaaa tgtcattgga      2460
     gccttgaagt tgctggacgc cggggcgagc ccgacgattg cctttgacga attcatcaag      2520
     tcagcgcagg tgcacatcga tggaatacgg aacaactcct ccgagcaagt gaagagaaga      2580
     ttcgatgcta gcgtaaccca gcctatcata ttgagtgtcc tcaaagatca gccatccgtg      2640
     gccccgaagc ttctggcccg aggcgcagat cctaatacac tgacgaagga agggcaccag      2700
     atacagcatg aggttcacgc tagggcctac cgacatggca aatcactgct ggattgtgtg      2760
     cgggaaaagc tgaatgctct gcgtgcgtac gagcccgaga ctgactcccc ggagccgccc      2820
     agacccttgg agcacgagga cagctactat ctctcgccgt tcagagaaga cacataccag      2880
     ctgtggacgg ccaaagccgc tctccgcagt gcacactcca gtcttgaatc agagcagaag      2940
     cgctatgacg acgacgtgaa gtgtgccgcg aaccgcaagg gtgtcgacga gaagaaggcg      3000
     gccgttcaac tgacgctcgg cgagtttgag aagcttgagg aggaattact tgcccggggc      3060
     gccaaggagt tcaagcagct gtttccggac attagaacgc cttctgataa cgacgggaat      3120
     cattacggat cctgtgccac caaatctgag tcgttcaggg tgacctttga cttcaggagg      3180
     ccggatctca acgacatcac cagggaaggc tatatccaac tgtcggtgct cctccggttc      3240
     cttccgtttg aggcagcgtg gtgtggtgac cttgagacca tcaaatcact cacccttggg      3300
     acatggggtc cagacaagca gagaccgccg ctggagattg ctacgaagga ccagagaaac      3360
     ttccacccgt tcaacatcgc cgtcctacgt ggacatttgg acgtggcgaa ggcgattctc      3420
     gccattgcac aagtgcagta caagcctcag gacgagcaag caaatgtgcg gtataggctg      3480
     cgagcaacaa ccaatcatga cgatggttgt tccagcgacg acgagggcga cgaggacgat      3540
     aacgacaaca gtgacggtct ggatatcgag aggcagatcc tcgatgaaaa attcactatc      3600
     gacaacattg gtgaggtcaa gacgcaggtc gaaagcagga ccccgcctct ttcccttttg      3660
     gaggactgtt gctcggctga agatttcata gagacaagcc tgccggagga ccgaaagcct      3720
     tataatcttg tacagtacgc aatctgtaag gatgatgtta ggctactagt cttccttctg      3780
     gacctcggcc gggagctgtc tgcgaagtcc ggaagttctg agcagaccat ctttacggtt      3840
     ggacagcggg atcttactgt ggcgatgcag ctgggacgag tccgctgcct ggccgaactc      3900
     atcaaacgta cgggggctgg catacaactg gataagctgg cggagcaaag cggagtggaa      3960
     atcaaggaga agcccaaata ctaccaagga ctgtccatcc acgggaagaa gcgagcggac      4020
     tgggcagccg ccggtcgcgg catcctcccc gtacagcctg aggagggaaa acctcccctt      4080
     ctagttgctg cgcgtgaagg taacctcgaa acagtggagt ggttcttggg aactgcacct      4140
     ggtcgatact atatggagtt taccgagtgt caccagcgtg acaagcgcgt taagaggctc      4200
     accatgggaa agttgggagt cgagcgttcc attacaaact ggttgaatcg cagacgcgat      4260
     cttgtcctcc actgtgccct cttcgcaaag ccaacggccg agtcagaacg actcgtcaag      4320
     tacttggttc agcacgtccc tcactgtctg gaggttaaat ccgttgatgg atataccccc      4380
     ttgatgattg cattctcgct tgttcgtcct acttatgcca aaatcctcat caaggccggg      4440
     gccgaccaga ccgtgcgcga caagaagggc tgcaacatcc ttcaccacct gttctgcggt      4500
     gtcagctccc cctcggtcga gaggctggat gacttccaga agatgctcgg actggttgac      4560
     ccgtctttgg tttcctccct gctcgtcgag cgttcgtcac acgggcccgg ctcgctgaca      4620
     cccttggcaa tgtggatgat gcgggccttg aacaccacga atacctactc cgtctatggc      4680
     aatggaagca actatgaagg cgataaccag atggaaactc ttcgaataat cttggacttt      4740
     gctcaaagta ccgggcagaa gcatcttgaa ctattgaacg gggccggcaa cagcatcatg      4800
     cacgatgccg tgcggtgcca gctcctcaaa acgctggaga ttttgttcga acgccgtccg      4860
     gatctcctcc accgcgagaa cgcttctggc ttgacgcctg ctgaagtcgc cgaggcctcc      4920
     tgggtcactg aagttacatc caatcctcct ggatgggagc ggcgatacag gttcacgtac      4980
     agcagtcagt atggagagag ccttgtggat cgtcgacccg aatccttcgt cgaggagggt      5040
     gatgaagccc caacgatgaa acggaggatc tacgacttct gccgcagcaa ggcagagact      5100
     ttgagagaac cggatgcgaa gcgtagattg gtcactctgt ttgaggccaa tgaagtcgcc      5160
     agaagactag ttgccaagga tctacaggag aatcaaaatt tcggcggtgc agccagaagg      5220
     agaagatggg acaagcatga cgaaagagaa tttggcgatg aggttcggga atggcttcca      5280
     gaggtgtttt ag                                                          5292
//

If you have problems or comments...

PBIL Back to PBIL home page