(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE143

ASFUM1_4.PE143       Location/Qualifiers
FT   CDS_pept        430010..430891
FT                   /codon_start=1
FT                   /gene_family="HOG000048698" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274695"
FT                   /orf_name="AFUA_4G01590"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84260.1"
FT                   /db_xref="HOGENOM:HBG054425"
FT                   /db_xref="UniParc:UPI000051ED64"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9I0"
FT                   /transl_table=1
FT                   /translation="MVAVMNQLTDLPNWYIDIFDDAIVAYWRQNPDLASIVTNPLLSDR
FT                   AWDWCLHELRDKAEEYQRQRHVRVLDTGSCICKSDDVPGLPNGTGALADEIRPAVKTVL
FT                   QKWSKSGWLDWRSKQRLSIIDPMLFPLVYGRSLVLTDRGRVELEDVFGAYSVATTIAPM
FT                   HVDLRTDAAAVQKRLEEAQRLHMGVSCDTETSTHYRWSANHQALPCEVEFVGDKGSTQV
FT                   RITSYINNLHPAHQDIYCAIETLVGRAIPLWNDCLVQGQSGWTDVLNQGHLGPVPLRII
FT                   TYGAEWENELPE"
     atggtggccg tgatgaacca gctgactgac ctcccgaact ggtatattga catttttgat        60
     gatgcgatcg tggcatactg gcggcaaaat cccgacttgg cctcgatcgt cacgaatcca       120
     ctgctgagtg accgtgcttg ggactggtgc ttgcatgagc tgcgtgacaa agccgaagaa       180
     taccagcgcc aacggcatgt acgggtgctc gataccgggt cctgtatttg taagtctgac       240
     gatgttccgg ggctcccaaa cggcacagga gccctggcgg atgagatccg acctgcggtg       300
     aaaaccgtgc tccaaaaatg gagcaagtct ggttggctgg attggcgctc gaaacaaagg       360
     ctctctatta ttgatccaat gctctttccg ctcgtgtacg ggcggagtct ggtcctgact       420
     gatcgaggtc gagtggagtt agaggatgtt tttggcgcat attcagttgc gacaacaatt       480
     gccccaatgc atgttgattt gaggaccgac gcggcggctg tgcagaagcg cctcgaggag       540
     gcgcagcggc tgcatatggg cgtgagttgc gacacagaaa caagcaccca ttatcgatgg       600
     agcgccaacc atcaggctct accttgtgag gtggagtttg tcggggataa aggatcgacg       660
     caggtgcgca ttacctcgta catcaataat ctgcacccag cacaccagga catctactgt       720
     gcaattgaaa cgctcgtggg tcgggcaatt ccactgtgga atgactgcct ggtgcagggc       780
     cagagtggct ggacggatgt cctgaatcaa ggccacctag ggccggtgcc actgcgtatc       840
     atcacgtatg gagcggagtg ggagaatgag ctccccgaat ga                          882
//

If you have problems or comments...

PBIL Back to PBIL home page