(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE144

ASFUM1_4.PE144       Location/Qualifiers
FT   CDS_pept        430983..432161
FT                   /codon_start=1
FT                   /gene_family="HOG000048699" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19905737"
FT                   /orf_name="AFUA_4G01600"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84259.1"
FT                   /db_xref="HOGENOM:HBG054358"
FT                   /db_xref="UniParc:UPI0000520533"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9I1"
FT                   /transl_table=1
FT                   /translation="MRADENAERCEDYLRDLLMWRETKTRSYLLQIPTSGNARKNIFSS
FT                   QKMDRPPLFQSQTTGSNLPGSISKTSCGDYCTSAIRNQGPRFPTINGRRAVIMTRPWSI
FT                   WSASGKIGIRSRPPRITPPPHKYYTIQLQDKFREHGLQIIVKMENIELTPDSGSYKGTD
FT                   WRIEGQLNEHLVAAAVFAYDVANITEPRIAFRQNTKLDERFYRCSEDREQRRKVHPRHD
FT                   VPAQQCGKYGSTEFAAVAEILGFSTADLDPCCNHAVKTWQDKGTVRVLQGRLVTFPNLL
FT                   EHRYEPFALADPSRPGCFRFIVLYLVDPHYRVCSTRNVPPQQHHWWAESVSHNLAAAGL
FT                   PQEIVDEIMQGTGSWPMGLPEARRHRREFLKEHRWNNLVRIYCMRRPSFDCY"
     atgagggccg acgaaaatgc cgagaggtgc gaggactact taagggattt gctgatgtgg        60
     agggaaacga agacaaggag ctacctcctc cagattccaa cctctggcaa cgcgcgaaag       120
     aatattttca gctcccagaa gatggatcgg ccacccctgt tccagtccca gacaactggc       180
     agcaatctcc ctgggagcat atcgaagaca agttgcggcg attactgcac ttccgccatc       240
     cggaaccagg gacctcgttt tcctacaatc aatggaagac gggccgtcat catgacaagg       300
     ccgtggtcga tatggtccgc gagcggaaag attggcatcc ggtcacggcc cccacgtatc       360
     acgccccccc cccacaagta ctataccatc cagctccagg ataagttccg cgagcatggt       420
     ttacagatta ttgtgaaaat ggagaacatc gaactcaccc cagatagtgg aagttacaaa       480
     ggaacggatt ggcggattga aggccagctc aatgagcatc tcgtcgccgc ggctgtgttt       540
     gcatacgatg tggcgaatat caccgagccc cggatcgcct ttcgtcagaa cactaagcta       600
     gatgaacgct tctaccgatg cagcgaggac cgagagcaga ggcggaaagt gcacccccgc       660
     cacgatgtgc cagcgcaaca atgtggtaag tatggctcga cagaattcgc agcagttgcc       720
     gaaattctgg gattctcgac tgccgacctg gatccttgtt gtaaccacgc agtaaaaacc       780
     tggcaggata aaggtacagt cagggtctta caggggcgct tggttacatt ccccaacctt       840
     ctagagcacc gttacgagcc ctttgcgctg gccgacccga gtcgccctgg atgttttcgc       900
     ttcatcgtgc tgtacctggt tgatcctcac tatcgcgtct gctccactcg caacgtgccg       960
     ccacagcaac atcactggtg ggcagagtcg gtcagtcata atctggccgc ggccggattg      1020
     ccgcaagaga tcgtcgatga gatcatgcaa ggcaccggca gctggcccat ggggttgcct      1080
     gaagcccgac ggcaccggcg tgaattcctg aaagagcacc gttggaacaa tcttgttcgg      1140
     atctattgca tgcgtcgtcc gtcctttgac tgttactga                             1179
//

If you have problems or comments...

PBIL Back to PBIL home page