(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE15

ASFUM1_4.PE15        Location/Qualifiers
FT   CDS_pept        join(65900..65908,65963..66037,66091..66243)
FT                   /codon_start=1
FT                   /gene_family="HOG000178587" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19058737"
FT                   /orf_name="AFUA_4G00235"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27175.1"
FT                   /db_xref="HOGENOM:HBG627799"
FT                   /db_xref="InterPro:IPR007513"
FT                   /db_xref="UniParc:UPI0000F51BC5"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA87"
FT                   /transl_table=1
FT                   /translation="MGNGAKAASKRERKAKDTKSTATSQLKANEAAKDIICLTCRQTFL
FT                   KTTRAPALTEHASNKHNKTLQDCFPGFVDAPKK"
     atgggtaacg gagctaaagc cgcgtctaag cgtgagcgca aagccaaaga caccaaaagc        60
     accgcaacgt cgcagctgaa agcgaacgaa gctgccaagg acatcatatg ccttacttgc       120
     aggcagacgt tcctcaagac tacgcgtgct ccggctctga cggagcatgc ctcaaacaag       180
     cacaacaaga cgcttcagga ttgttttcct ggctttgtag acgctcctaa gaaatga          237
//

If you have problems or comments...

PBIL Back to PBIL home page