(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE151

ASFUM1_4.PE151       Location/Qualifiers
FT   CDS_pept        join(762040..762396,762515..762523)
FT                   /codon_start=1
FT                   /gene_family="HOG000048686" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19905739"
FT                   /orf_name="AFUA_4G02740"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84422.1"
FT                   /db_xref="HOGENOM:HBG054332"
FT                   /db_xref="UniParc:UPI000051E816"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA41"
FT                   /transl_table=1
FT                   /translation="MSGMIISMPPGYRLSSRISGDIALISCLAKSLRDPHQHDENKIMS
FT                   RTPRSMQARIGMSISSQWPERSAYWRSDEGFSVHHLTLAWMITEADMHDACRQDGSEAE
FT                   KVEDVLLQRVQLPELDR"
     atgtccggca tgatcatttc gatgcccccg ggttatcgtc tgtcatcccg catctccggg        60
     gatattgcct tgatttcgtg cttggccaaa tcactcagag accctcacca gcacgacgaa       120
     aacaagatca tgagcaggac gccccgctcc atgcaagcca ggatcggaat gtccatatcc       180
     agccagtggc ccgagaggag cgcctactgg cgaagtgatg aaggattctc cgtgcatcat       240
     ttgacacttg cctggatgat aacagaggct gacatgcatg atgcatgtcg tcaagacggt       300
     tctgaagctg agaaggtcga ggatgtgtta ctgcaacgag ttcagctgcc ggaacttgac       360
     aggtga                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page