(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE153

ASFUM1_4.PE153       Location/Qualifiers
FT   CDS_pept        join(764140..764270,764445..765288)
FT                   /codon_start=1
FT                   /gene_family="HOG000217304" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19059013"
FT                   /orf_name="AFUA_4G02760"
FT                   /product="DUF829 domain protein (PaxU), putative "
FT                   /protein_id="EAL84424.1"
FT                   /db_xref="HOGENOM:HBG054333"
FT                   /db_xref="InterPro:IPR008547"
FT                   /db_xref="UniParc:UPI000051E817"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA39"
FT                   /transl_table=1
FT                   /translation="MNVKAKKRIGQLDQYWGQKNWRLCQVEKEMKGMAYNGEGAAPFLS
FT                   VIPHFTRIATRTWLSTPDKALPGQLVIVCTWLGASAKHITKYTDLHRSIAPHARILLIE
FT                   SEVSILVSSYARQRRLIRPAVDVVLETLADRTESDAPRILLHTFSNGGTNTATQLLITL
FT                   AKTVSQPLPLVGLVLDSTPARGTYWKSYNAMVFSLPPSSRLVGSVVVHFLLILLYTWIA
FT                   CGNENPASLMRRTLLDEETVGPAPQRDAPGYVCYMYSKEDRMTDWRDVWDHAQEAEEKG
FT                   WKVDKVLFEGTGHCAHMPDNPARYAEAVEKAWNSALCKIESKL"
     atgaacgtga aagcaaagaa acgaatcgga caattggatc agtattgggg gcagaaaaac        60
     tggcggctat gccaggtcga aaaagagatg aagggaatgg catataatgg agaaggggca       120
     gccccctttt tgtctgtaat tccacatttt actcgtatag ccacacgcac ctggctctcc       180
     actcccgaca aagcgctgcc gggccaactt gtcattgtct gtacctggct gggggcctcg       240
     gccaagcaca tcaccaaata tactgatctg caccgctcca ttgcgcctca tgcccggatc       300
     ctgttgattg aatccgaggt ctcgatccta gtgagcagct acgcgcgcca gcgtcgactg       360
     atccggcccg ccgtggacgt cgtcctcgag accctagcag accgtactga aagcgacgcg       420
     ccgcgaatcc tgctgcatac attctctaat ggcgggacca acaccgcgac gcagctgttg       480
     attacgctcg caaagactgt atcccagccg ttgccgctgg tgggactcgt gctggacagt       540
     acaccggcaa ggggaacgta ctggaaatcc tacaatgcca tggtcttctc tcttcctccc       600
     tcatctcgcc tcgtgggctc cgttgtggtg cactttctct tgatcctgct gtacacctgg       660
     attgcatgcg gaaacgagaa cccagcaagt ctaatgcgcc gcaccctcct ggatgaggag       720
     acggtcggtc cagcgcccca acgagatgcc cctggatacg tgtgctacat gtattcgaag       780
     gaggatcgta tgactgactg gcgggatgtc tgggatcacg ctcaggaggc cgaagagaag       840
     ggttggaagg tcgacaaggt gctttttgag ggtacgggtc actgcgcgca catgccagat       900
     aaccctgcac ggtatgcgga agcagttgag aaagcatgga actccgctct gtgcaagatt       960
     gagtctaagc tgtag                                                        975
//

If you have problems or comments...

PBIL Back to PBIL home page