(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE156

ASFUM1_4.PE156       Location/Qualifiers
FT   CDS_pept        join(complement(771605..771649),complement(770570..771457))
FT                   /codon_start=1
FT                   /gene_family="HOG000161070" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274697"
FT                   /orf_name="AFUA_4G02790"
FT                   /product="Carbon-nitrogen family hydrolase, putative "
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds"
FT                   /biological_process="nitrogen compound metabolic process "
FT                   /protein_id="EAL84427.1"
FT                   /db_xref="GO:0006807"
FT                   /db_xref="GO:0016810"
FT                   /db_xref="HOGENOM:HBG054337"
FT                   /db_xref="HOGENOM:HBG330305"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="UniParc:UPI0000520904"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA36"
FT                   /transl_table=1
FT                   /translation="MPPFCKIAVIQLYVKPLKPEDNFARAVKFITEAAAQGCHLAVLPE
FT                   FHLTNWIPTDPRFASLCNDWETYLHRYQALAKERNICIVPGSIVRPVSASPTAAAGATV
FT                   SDKQTPSLENVTFFISNTGEILGSYVKKNLWGPTERAYLRSSGDSPHQVISTPLGPVGL
FT                   LVCWDLAFPEAWRELASQGAKIIIVPTLWTRSGASEAGHRQNPSAPSLFLDSILTARTF
FT                   ENTCAVVFANAGGPPGRNYCGLSQINIPYAGPLVRLGTSAEGMGVATLDLAVLEDAEEN
FT                   YAIRSDLTDPSWHYRHTRRVPVESPKGRL"
     atgccaccat tctgcaagat tgctgtcatt caactctatg tcaagcccct caaacccgaa        60
     gacaacttcg cccgggctgt gaaatttatc accgaggctg ctgcacaggg ctgtcatttg       120
     gctgtactgc ctgaatttca tctgacgaac tggatcccta ctgatcctcg ttttgcttcc       180
     ctctgcaatg actgggagac ctatctgcat cgttatcagg ccctcgctaa agagcgtaac       240
     atatgcatcg tacccgggtc gatagtccga cctgtgtctg cttcgcctac agctgcagca       300
     ggggccactg tctctgataa acagacaccg agcctagaaa atgtaacctt cttcatctcc       360
     aacacgggtg agattctcgg ctcctacgtg aaaaagaacc tctggggacc caccgagcga       420
     gcgtaccttc gatcgtccgg cgacagtcca caccaggtca tttcgacccc gctgggccca       480
     gtaggcttgc tggtgtgctg ggacctagcc ttccctgaag cctggagaga attggcatcg       540
     cagggagcta agatcatcat tgtgccgacc ctctggactc gcagcggcgc ctctgaggcc       600
     ggccatcgcc agaacccaag tgcgccctcc ctgttccttg acagcattct gactgcgcga       660
     acatttgaga atacctgcgc tgttgtcttt gccaatgcag gcggacctcc agggagaaat       720
     tactgcggac tctcccagat caacattccg tacgcgggtc ccctggtccg tttaggtact       780
     tccgccgaag gaatgggcgt ggcgacactc gatttggcgg ttttggaaga tgcggaagaa       840
     aactacgcga tacgctccga tctaacagat ccttcatggc attacaggca cactcgccgg       900
     gttccggtgg aatcacccaa aggaaggcta tag                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page