(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE162

ASFUM1_4.PE162       Location/Qualifiers
FT   CDS_pept        join(complement(794336..794644),complement(793618..794154))
FT                   /codon_start=1
FT                   /gene_family="HOG000171770" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274701"
FT                   /orf_name="AFUA_4G02840"
FT                   /product="NmrA-like family protein, putative "
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="EAL84432.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG054341"
FT                   /db_xref="HOGENOM:HBG326793"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000520693"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA31"
FT                   /transl_table=1
FT                   /translation="MTLKYLITGATGGLGKEVLAYFEANRPSSEYAAASSRESNRKQFE
FT                   ERGIAFRHVDYDDPRTLDAAFPGVENLFFVSTNVFDNEKRIKQHRNFVEAAKRAGVKHF
FT                   TNHSRSGLTFTSIREGVYADAFPLFINWYPDTTTVSLPADGRCAFTLRKELGEANARLM
FT                   LQGGHENEIVLLTAGETISFAETVDVINETTGRNVRFQIVSPEEYVRLSAANDQGGKPA
FT                   EFFQALVSWYDSVAQGEISHTHPLMKEVLGREPTTPREAIRGFLLENRDYTWHQNYVNK
FT                   "
     atgaccctca aatatctcat taccggagct acaggcggtc ttggcaaaga agtcctcgcc        60
     tacttcgaag ccaaccgtcc ctcctcagaa tatgcggccg cttcctcgag ggagtcgaat       120
     cggaaacaat tcgaagaacg aggaattgcc tttcgccatg tagactatga tgacccgcgc       180
     acgctcgatg ccgcgtttcc gggcgtcgag aacctcttct ttgtcagcac taatgtcttt       240
     gacaatgaga agcgcatcaa gcagcatcgg aatttcgtgg aggctgccaa gagagcgggg       300
     gttaaacact tcactaacca ttccaggtcg ggactcacat tcacctcgat tcgcgaagga       360
     gtctacgccg atgcattccc gctgtttatc aactggtatc ctgacaccac caccgtgtcc       420
     ctccccgccg acggacgctg cgctttcacc ctgcgaaagg aactcggcga ggccaacgcc       480
     cgattgatgc tccagggtgg ccacgagaac gagatcgtcc tcctgaccgc aggggagacc       540
     atcagtttcg ccgagacggt ggatgtcatt aacgagacga cggggcggaa cgtccgattc       600
     cagattgtct cgccggagga gtatgtccgc ttgagcgcag caaacgacca gggaggcaag       660
     cccgccgagt tcttccaggc gctggtgagc tggtacgaca gtgttgcgca gggggaaatc       720
     agccataccc atccgttgat gaaggaggtg ctggggcggg agcccaccac gccgcgggag       780
     gcgattcggg ggtttttgct ggagaatcgg gactatacat ggcatcagaa ttatgtcaat       840
     aagtaa                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page