(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE166

ASFUM1_4.PE166       Location/Qualifiers
FT   CDS_pept        join(804443..805363,805537..805689)
FT                   /codon_start=1
FT                   /gene_family="HOG000171725" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274705"
FT                   /orf_name="AFUA_4G02880"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84436.1"
FT                   /db_xref="HOGENOM:HBG054343"
FT                   /db_xref="HOGENOM:HBG329730"
FT                   /db_xref="UniParc:UPI000051EC80"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA27"
FT                   /transl_table=1
FT                   /translation="MLNSITELPEGVAKNSEIHSLAIRILVVVFNSIALYNAVELVILI
FT                   FLTFNRYSGLYFWSLLLSGVLGVIPHAVGHLLQFFRIGPIGLAISIATIGFYFMVPGQS
FT                   FVLYSRLHLVVQNQKLLRRVLYIIIIDSIVLLIPTTVLNYLTVYVGTQPVIKGYNFVER
FT                   MQISWFTAQEMFISGIYIVETIKLLRLRPDKASSRNKIMYELIAINLVMVLLDVALLVL
FT                   EYLGLYTLQVTLKAAVYSVKLKLEFGVLRKLVSLIHAPQVSSTTDVDEYPTFVDPSRIT
FT                   GDVTHAAPVNQRTSSRRWDAISLDSLPASTFCLSQTEIPSSRLHWADTIIGMNMTLALE
FT                   LGIMYDFGQDTPVHLQP"
     atgttgaact ccatcactga gcttcctgag ggtgtggcaa aaaactctga aatccacagc        60
     ctggcaatac ggatcttggt ggtggtgttt aactcgatcg ctctttacaa tgccgttgag       120
     ctcgtgattc tcattttcct tacgttcaat cgctacagtg gcctctactt ttggagtctt       180
     ctattgtcgg gtgtacttgg ggttattccc cacgctgttg gtcacctgct gcagttcttc       240
     cgtattgggc ccattggtct cgccatctcc attgccacta ttgggtttta cttcatggtg       300
     cccggccagt cgtttgtgtt gtactcgcga cttcatttgg tggtgcagaa tcagaaactt       360
     cttcggcgcg tactgtacat tatcatcatt gactccatcg tcctgctgat tccaacgact       420
     gttctcaact atctgaccgt ctacgtcggc acccagcccg ttatcaaagg atacaatttt       480
     gtggagcgaa tgcagatttc ctggttcacc gcccaggaaa tgttcatttc tggaatctat       540
     attgtggaga ccatcaagtt gcttcggttg cggccggaca aggcatcgag ccgaaacaaa       600
     atcatgtatg agttgattgc tatcaacctt gtaatggtac tcttggacgt ggctcttctg       660
     gtcttggagt atctcggtct ctacacactc caggtcacac tcaaggcggc ggtctacagt       720
     gtcaagctca agctcgagtt tggcgtactg aggaagctgg tctctctcat ccatgctcct       780
     caagtctcga gtaccaccga cgtcgatgag tatcccacct ttgtcgaccc atctcgaatc       840
     actggcgatg ttacacacgc ggcgccggtc aatcaacgca cctcctcacg ccgatgggat       900
     gcaatctcac tcgacagcct tcctgcaagc actttttgtc tcagccagac tgagattccg       960
     agcagccgtc tgcactgggc tgacaccatt atcggtatga acatgacctt ggctctcgag      1020
     cttggcatca tgtacgattt cggtcaggac acacctgtac accttcagcc gtga            1074
//

If you have problems or comments...

PBIL Back to PBIL home page