(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE167

ASFUM1_4.PE167       Location/Qualifiers
FT   CDS_pept        join(806022..806572,806970..807123)
FT                   /codon_start=1
FT                   /gene_family="HOG000217297" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274706"
FT                   /orf_name="AFUA_4G02890"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84437.1"
FT                   /db_xref="HOGENOM:HBG054345"
FT                   /db_xref="UniParc:UPI000051F897"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA26"
FT                   /transl_table=1
FT                   /translation="MQQVYTHEGPYESIPSTASPGLQFLRHFLPALDSLDPTTNPISRF
FT                   IHPDARVVVGSGPPNRGTDVIGLLNVRQRHIQRFQHEIHKAWDIARPDTGNGNGGPRTV
FT                   MFEATSGTVFRNDPDEFEVQVREFNILELQRAGSQSNGDGEGKGGFVAVEMRTFMDARP
FT                   VQDQAARLQRESAYGEAKSTGWDHSTLNCRTSLQWVQPGWQHRIELCEVQSLTLISQLG
FT                   FLSGPAVAANVY"
     atgcagcaag tctacaccca cgaaggaccc tacgagtcaa tcccctcgac cgcatcgcca        60
     ggcctccagt tcctcagaca cttcctccca gccctggact ccctcgatcc aactacaaat       120
     cccatctccc gcttcatcca tcccgacgcc cgtgtcgtcg tgggcagcgg accccccaac       180
     agaggcacag acgtgatcgg tctcctaaac gtccgccagc gacatatcca gcgctttcaa       240
     cacgagatcc acaaggcgtg ggatattgca cggccggata cagggaacgg aaacggcgga       300
     ccccggacgg tgatgttcga ggcgacgagc ggcaccgtct tccgtaatga ccccgatgag       360
     ttcgaggtgc aggtgaggga gtttaacatc ctcgagctac agagggcagg ctctcagtct       420
     aatggcgacg gcgagggtaa gggtgggttt gtcgcagtcg agatgcggac gttcatggat       480
     gctcgaccgg tgcaggacca ggcggcgcgg ttgcagcgcg agtcggcgta tggggaggca       540
     aagtcgacgg gctgggatca ctccactctg aactgccgca cgtccttaca atgggtccaa       600
     ccaggttggc aacatcgaat tgagctctgt gaagtccagt ccctgacctt gatttcacaa       660
     ctggggtttc tcagtggtcc cgctgtcgcg gcaaacgtgt actga                       705
//

If you have problems or comments...

PBIL Back to PBIL home page