(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE168

ASFUM1_4.PE168       Location/Qualifiers
FT   CDS_pept        join(807605..811417,811473..811787)
FT                   /codon_start=1
FT                   /gene_family="HOG000171704" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274707"
FT                   /orf_name="AFUA_4G02900"
FT                   /product="Sensor histidine kinase/response regulator,
FT                   putative"
FT                   /function="ATP binding"
FT                   /function="G-protein coupled photoreceptor activity "
FT                   /function="two-component response regulator activity "
FT                   /function="two-component sensor activity"
FT                   /biological_process="peptidyl-histidine phosphorylation "
FT                   /biological_process="protein-chromophore linkage "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /biological_process="sensory perception"
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL84438.1"
FT                   /db_xref="GO:0000155"
FT                   /db_xref="GO:0000156"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0007600"
FT                   /db_xref="GO:0008020"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0018106"
FT                   /db_xref="GO:0018298"
FT                   /db_xref="HOGENOM:HBG054346"
FT                   /db_xref="HOGENOM:HBG327489"
FT                   /db_xref="InterPro:IPR001294"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013515"
FT                   /db_xref="InterPro:IPR013654"
FT                   /db_xref="InterPro:IPR016132"
FT                   /db_xref="UniParc:UPI000051FFB9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA25"
FT                   /transl_table=1
FT                   /translation="MASRANASSPTRQKNDEDLSETTSGAVGEEGAVTRAPKSGMESST
FT                   GFESEDRVYPIRSVISVDPSTVSQSQQQAESNLSSPATGAREWSIINAETWDKMRAQTK
FT                   TSAGNFSATEPPPPAPDTAGSSSEPPDQGRSHSASPTPTPDSALTKTQDPEVDSEHGLV
FT                   TARFRHVVTDGGHMVITGRANDSYQACEDEPIHIPGAVQSFGCLLVLREEIEGKLVVRV
FT                   ASENSEVILGHSPKCLFALPNFCDILDEEQKDNLLDHLDLIRDDGFDPSVDGPEVFLLS
FT                   VKLPSGKPRRFWCATHLSPADSNSIICEFELEDDRINPLSVSGLTTPVTPTDTLGVEPT
FT                   PEQLEHSTVNISQPLRLLRNARRRRGEAAAMEVFSILSQIQDQLGRTKSLDSLLNTTTG
FT                   LVKELTGFHRVLIYQFDTEWNGTVVAELVDPKASVDLYKGLCFPASDIPKQARDLYRIN
FT                   KVRLLYDRDQVTSRLVCRTLEDLQTPVDMTHSYLRAMSPIHLKYLANMGVRASMSISIS
FT                   GFNELWGLISCHTYGTHGMRVSFPVRKICRLIGDTVSRNIERLSYASRLQARKLINTVP
FT                   TDQNPSGYIIATSDDLLKLFDADYGALSIRNETKLLGKMTHSQEILALLEYLRMQRMNS
FT                   VVASHHITKDFPDLFYAPGFKHISGMLYVPLSAGGTDFMVFFRRGHLTEIKWAGNPYDK
FT                   KPQNGHLEPRKSFQTWRETVLDQSREWTESDVETAAVLCLVYGKFIKVWRQKEAAMENS
FT                   QLTRLLLANSAHEFRTPLNAVINYLEIALEGSLDPETRDNLTKSYSASKSLIYVINDLL
FT                   DLTNAEKGQKLIKDEIFDLPATFREATDMFEGEAKRKSIHYKVVAHPGLPPAVIGDQRR
FT                   VRQVFTNLISNAVRHTTAGSVTTEIWRSLEQAQPGCVVVQMTVLDTGSGMSQSTLEALF
FT                   QELEQVSTDDDNYWFDPEDQTHPLDSCSQDKRVLGLGLALVARIVRNMHGQLSVRSEKG
FT                   KGSYFEISLNFPVPDDVASGESEEPSVPDIVEPAVPIQQEVEFMLVDSKSTRGGEQRRR
FT                   STGSDHSKGSYNSSRSGRSNRSEADRLISAMQDSPLLQRTTSEGSEERDPRPVERTQGS
FT                   AHNRHAMSTQSLPNLKDESIPEQWPVTQAPAFPSTSRTMMPPVSPPLPGHEPVTDSGVP
FT                   MTAIRIPLEDVERPPSPPAKAFLSQPGTSAELPSAAEPSSAPAPNAEPTTLRVLVAEDD
FT                   PVNSKIVEKRLSKLGHAVILTGNGEECAAAFRRDSTKVDVVLMDIQMPIVDGTESTRMI
FT                   RQFEQEFQPPLSEKASRNGHVPVFAVSASLLEKDAQLYIEAGFDGWIMKPINFNRLGVL
FT                   LDSLENHDIRNATIYRPGYWELGGWFKHHGEL"
     atggcgtcaa gagccaatgc ctcctctcca acgaggcaga aaaatgacga ggacctctcc        60
     gaaacgacgt caggtgctgt aggagaggaa ggcgccgtga ctcgcgcacc gaagtcagga       120
     atggagagtt ccactggctt cgagagtgaa gaccgagtgt atccaatccg gtcggtcatc       180
     tccgttgatc cctcaacggt ctctcagtcg caacagcagg cggagagtaa tctgagctca       240
     cccgccaccg gagcgcgaga atggtctatt atcaatgccg agacctggga taagatgcga       300
     gcgcagacaa aaacaagcgc aggtaatttt tccgctactg agccacctcc accagcgccg       360
     gatactgcag gttcatcgtc tgagccgccc gaccaaggcc gttctcacag cgccagtccc       420
     accccgactc cggattccgc tctgaccaag actcaggatc cagaggtcga ttccgagcat       480
     ggtcttgtta ctgcccgatt tcgtcatgta gtgaccgatg gtggccatat ggtcatcact       540
     ggaagagcca atgattctta tcaagcatgc gaagacgaac cgatccacat ccctggtgcg       600
     gtgcagagtt tcggatgttt gcttgtgctg cgggaggaaa ttgaagggaa gttggtggtc       660
     cgtgtagcca gcgagaattc tgaggttatc cttggacact cacccaagtg tctctttgca       720
     ttaccaaact tctgtgacat tttggatgaa gagcagaaag ataatctatt ggatcatctt       780
     gatctcatcc gcgacgatgg atttgaccct tccgtcgatg gccccgaggt tttccttttg       840
     tctgtgaagc tcccttctgg taaaccccgg cgattctggt gcgccaccca tctcagccca       900
     gccgactcaa attcgattat ctgcgagttt gaattggagg acgatcgaat caatcccttg       960
     agtgtttccg gactaactac cccggtgacg ccgaccgata ctcttggagt cgaaccgacg      1020
     ccggagcaac tcgaacacag cacagtcaat atcagtcaac ccctgcgatt gctacgaaat      1080
     gcgcgtcgga gacgaggcga ggccgctgca atggaggtgt ttagcatctt gtctcagatc      1140
     caagatcaat tgggtcgtac caagtcgctg gattctttgt taaacacgac cactggtttg      1200
     gtaaaagaat tgactggttt tcatcgtgtt ctgatctatc agttcgacac cgaatggaac      1260
     ggaactgttg ttgctgaact ggttgatccc aaagcgagcg tcgacttgta caaaggactc      1320
     tgctttccgg cctcggatat tccgaagcaa gcgcgtgact tgtatcggat caacaaagtt      1380
     cgcttgctgt atgatcgcga tcaggtcaca tcgcgattgg tctgtcggac gctggaggac      1440
     ttgcaaacgc ctgtagacat gacacattcc tacttgcgtg caatgtcgcc catccacctc      1500
     aaatatctgg caaatatggg cgtacgtgct tccatgtcga tcagtatcag tggcttcaac      1560
     gagctgtggg gtctcatctc atgtcacacc tacgggactc acggcatgag agtctcattt      1620
     ccggttcgaa aaatctgccg gttgattggc gacactgtgt cgcggaatat cgaacgtcta      1680
     tcttacgcat cacggctcca agcccgcaaa ctgatcaata ccgtaccaac cgaccaaaac      1740
     ccctcgggat acatcatcgc cacttcggat gacctgctca aactctttga cgccgactat      1800
     ggtgctctct caattcgtaa tgagacgaag cttctaggaa agatgacgca ctcacaggaa      1860
     atcttggctt tactggaata cctcaggatg caacggatga attctgtggt tgcttcacat      1920
     cacatcacta aagactttcc cgacctcttt tatgctcctg ggtttaagca catctccggc      1980
     atgctctatg tgcctttgtc ggccggtggc actgatttca tggtcttctt ccgtcgggga      2040
     catcttacag agatcaaatg ggccggaaac ccgtatgaca agaaacctca aaacggccat      2100
     ctggaaccgc ggaaaagttt tcagacctgg cgagaaacag tcctagacca gtctcgagaa      2160
     tggaccgagt ccgatgtgga gacggcagct gtgttgtgtc tcgtttatgg caagttcatt      2220
     aaagtgtggc gacaaaagga agccgcaatg gagaactcgc aattgacacg gctcctcctc      2280
     gcaaactcgg cccatgaatt tcgcacgccg ctgaacgctg tcatcaacta tctggagatc      2340
     gctttggaag gctccttgga ccctgaaacc cgcgacaacc ttacaaaatc ctactctgca      2400
     tctaaatctc tgatctatgt catcaacgac cttctggatc tgaccaacgc tgaaaagggc      2460
     cagaaactca tcaaggatga aatatttgac cttccagcca ctttccgaga agccactgat      2520
     atgtttgagg gagaggccaa gcgtaagagc attcattaca aagtagtagc gcaccctgga      2580
     cttcccccag cggttattgg cgaccagcgt cgggttcgcc aggtgttcac caatctcatt      2640
     tccaatgctg ttcggcatac aacagcaggc agcgtgacca cggagatttg gcgctctctc      2700
     gagcaggcgc agccaggatg tgtggtggtc caaatgaccg ttttggacac gggatcagga      2760
     atgtctcaga gcacccttga ggctttgttc caagaacttg agcaggtctc gacggatgat      2820
     gacaattatt ggtttgatcc ggaagaccag acgcaccctc tcgactcatg cagtcaggat      2880
     aaacgtgtac tcggcttggg tctggcgttg gttgctcgaa ttgttcgcaa catgcacggc      2940
     cagttgagtg ttcgatcgga gaagggcaag ggtagctatt tcgaaatctc acttaacttc      3000
     ccagttccgg acgacgtggc gtctggggaa tcagaagagc catctgtgcc ggatatcgtg      3060
     gaaccagctg ttccgattca gcaggaagtg gagttcatgc tcgtcgacag caagtccacc      3120
     cgaggcggcg agcagcggcg tcgcagtacc ggcagcgatc acagcaaggg cagttacaat      3180
     agctctcgca gcggcagaag caacaggagt gaagccgatc gattgattag tgccatgcag      3240
     gattcccctc tgctacaacg aacaaccagc gaaggatctg aggaaagaga ccccagacca      3300
     gtggaacgca ctcagggcag cgcgcacaac agacatgcaa tgtctaccca atctcttcca      3360
     aacttaaagg acgaatcgat tccggaacaa tggccagtga cacaagctcc cgcctttccg      3420
     agcacgtcac gcacaatgat gcctccggtc tccccacctt tacctggcca cgaacccgtt      3480
     accgactcgg gagtcccaat gacagcgatc cgaattcccc ttgaggatgt ggagcggcca      3540
     ccttcacccc cggccaaagc ttttctgagc caacctggaa cctcggcaga gctgccaagc      3600
     gcggctgaac catcctcagc acctgccccc aacgctgaac cgactactct gcgcgttctc      3660
     gttgctgagg acgaccctgt taacagcaag atcgtggaga aacgactcag taaattgggg      3720
     cacgctgtca tcctcacagg aaatggcgaa gaatgtgcag ctgcgtttcg ccgtgattct      3780
     acgaaggtcg acgttgttct gatggatatt cagatgccga ttgtcgacgg taccgagtct      3840
     accaggatga tccgccagtt cgagcaagaa tttcaacccc cgctgtctga aaaagcgagc      3900
     aggaatggcc acgtacctgt cttcgcggtt tcagcatcac tcctcgaaaa agacgcacaa      3960
     ctgtacattg aagccggttt tgacgggtgg attatgaaac ctatcaactt caaccggttg      4020
     ggtgttctct tggacagtct tgagaaccac gacattcgca atgccaccat ttaccgacct      4080
     ggctactggg agttgggagg ctggttcaaa caccatgggg agctctga                   4128
//

If you have problems or comments...

PBIL Back to PBIL home page