(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE17

ASFUM1_4.PE17        Location/Qualifiers
FT   CDS_pept        join(69578..69758,69815..70491,70574..71149,71205..72101,
FT                   72159..72980,73040..73261)
FT                   /codon_start=1
FT                   /gene_family="HOG000216785" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19905465"
FT                   /orf_name="AFUA_4G00250"
FT                   /product="WD40 repeat protein"
FT                   /protein_id="EAL84393.2"
FT                   /db_xref="HOGENOM:HBG054303"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI0000F51BE6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W948"
FT                   /transl_table=1
FT                   /translation="MDDKDAGRASCLSHQPSHLGISLHFIAQPVIKPPAGFPRRRPSSM
FT                   KDNGVSGLTQTIRAIKPGQGTPSYSPRIALQKGNGDGLPSPIFSSLTGIWSLLALRSDI
FT                   DDIILELLGRFSLEKVYADADKESYADLILTLLVQLRVIFFIQRLTLPPGGTIPVDWSL
FT                   GFLVSWEVTVRTVEFILQIVLEAREVLWDSPLRDEYLSRLVLSTVQILLLHPKTPPNSR
FT                   LRDRRDRFARVHRALERVCDNYPDTSSSFLAVCRAIADALRAEPNALSLPPRLKQELPS
FT                   LTGDLYPLPDCLSSSSVATFVPQHGSSQSWLSQLLGLYDVAQYVVGANVQFAVNTRKVC
FT                   DPKLERASKSSRDAVLHALNRIRLPPYVSAGHLIPMISKDFRVILPDTPSLGQHRRDGN
FT                   TVDALEALRERLGHRLMVHRVSDGAMMHSVSQITRYIELLDNPGDQLRSASPALYVVNC
FT                   QECHFLGSSLVRQIATLTHLDDAGGASGVALPTESRCAFCGSAVTMVREVSLARYTWEH
FT                   LKPLSPNVEAINAERHLPSQFLLAPSRFDPLRRDSGMASGPSSGPSSPPPFGLSAFPQG
FT                   RTNAPRAEPWVDGPPVLGNQRTSETPPPRTLRPAAGEPPFSADSVGGFEPLSKTTTFTH
FT                   TSSSSSAGIRALSPPTTSDKSRSKWKSRFASSKKETRDLADTSSLSSATLETQKLEEID
FT                   LKNLCRRGKHSAGGKFAQNIKVNLSQDSTYSLFWSQSSIQIWDVSTCPPTFKDAITPDG
FT                   FFILAAVTGTHVAYMTGDRDRKQTLWIQSLERMTTRPVEYRVGPTPWCTSMTVSPSGSF
FT                   VAVGFDKSTVGLFAPSEWQQPRLYRVHARYHQDCKDCPPIATVSFSHDGLALVCSTRSE
FT                   RNGMIQVFLSHFPFSEFQEVLPCRYRVPPPESEDNGISSVLFQPGIGGKEDIICITTWT
FT                   QSGVPILVHPNGGHRTEIRVQSSASSNHKGKLGNRIQAAAFSPSGHELVLANDKGYVYR
FT                   VSNLSSIPIEVRRVATSKEFTTKTESFALAYVHQTDEDLILVSWSDSSKGVGYVRKIPI
FT                   MTTGEVQHLQESNIVNATVHPSQPELPEFQPPEEKVPEKRQILVKPPVELEASEMSPPP
FT                   IQRPSRMGLFGSLHGKK"
     atggacgata aggatgctgg ccgtgcctcc tgtctgtccc accaaccatc ccatctcggc        60
     atttcattac acttcattgc tcagcctgtg attaagcctc ctgcggggtt cccgaggcgt       120
     cgaccatcgt cgatgaagga taatggagtg tctggcctga cccaaacgat ccgtgccata       180
     aaaccgggac aaggcactcc ctcgtattcc ccccgtattg ctcttcaaaa aggcaatggc       240
     gacggcttgc cctcgccgat attctcgagt ctgaccggta tctggagtct gttggctctg       300
     cgcagtgaca tcgacgatat catccttgag cttctgggtc gcttcagcct cgagaaggtc       360
     tacgcagacg cagacaaaga gtcgtatgcg gacttaattt tgaccttatt ggttcagctc       420
     cgagtgatat tcttcatcca gcgcctcaca ctccccccgg gtggcaccat ccccgtggat       480
     tggtcactcg gctttctggt cagctgggag gtgacggtgc ggacggtcga attcatcctc       540
     cagatcgtct tggaagcgcg tgaagtgctt tgggactctc cattgcgcga cgaatatctc       600
     tcgcggctgg tgctatcgac cgtgcagatt cttctgctgc acccgaagac cccgcccaac       660
     tctcggctca gagatcgtcg agaccgattc gcgcgggtcc acagggctct ggaaagagtg       720
     tgcgacaatt atcccgatac cagttcatct tttctcgcag tctgtcgggc aatcgcagac       780
     gctcttcgcg ccgaaccgaa tgctctgtcg cttcccccgc ggctgaagca ggaattgcca       840
     tccttgacag gagatctata tcctctgccc gactgcctct cctcgtcctc cgtcgcgacc       900
     ttcgtccccc agcatggttc ttcgcagagc tggttgtcgc agcttctagg cctgtacgac       960
     gtggcgcaat atgttgtcgg cgcgaatgtt cagttcgcag tgaataccag aaaggtctgt      1020
     gatccgaagc tggaacgggc atcgaagagc agtcgcgatg ccgtgctgca tgctctcaat      1080
     cgcatccggc tgccccccta cgtctctgcg gggcatctca tcccgatgat cagcaaagat      1140
     ttccgagtca tcctgcctga tacccctagc cttgggcagc accggcgcga cggaaacacg      1200
     gttgatgcgc tggaggcgtt gcgagagcga ctgggccatc gactgatggt tcaccgcgtc      1260
     agcgatggag ccatgatgca cagtgtatcc cagataacta ggtatatcga gctcttggac      1320
     aaccctggcg accagttgag atcagccagc ccggcattgt acgtcgttaa ttgccaagag      1380
     tgccatttcc tagggtcgtc actggtccga cagattgcaa ccctgactca ccttgatgat      1440
     gccggcggcg cgtcaggagt tgccctacct actgagtcca ggtgcgcgtt ctgtggctcg      1500
     gcagtcacta tggtacgtga agtatcgcta gcgaggtaca cttgggagca tctcaagccg      1560
     ctgagcccaa acgtcgaggc tatcaatgcg gaaagacatc tcccctcgca gtttctattg      1620
     gcgccatcgc ggttcgaccc gcttcgccgc gattccggaa tggcatcagg cccgtcatca      1680
     ggtccgtcat ccccgccccc ttttggcttg tctgcctttc ctcaggggcg aacaaacgcg      1740
     ccgcgcgcgg aaccttgggt cgatggtcca cccgtgctgg gtaaccaaag gacgagcgaa      1800
     acccctcctc ccagaaccct ccggccggcg gctggggaac ctccattctc tgccgattcc      1860
     gtgggaggct ttgagcccct cagcaaaacg accacattca ctcacaccag ctcatcatcg      1920
     agtgcgggca tccgagccct ctcgccccct actacgtcag ataagtcacg gtccaagtgg      1980
     aaatcgagat tcgcctcctc gaaaaaggaa actagggacc ttgcagacac cagctccctg      2040
     tcttcagcaa ctctggagac tcagaagctg gaagagatcg acctgaaaaa cctctgccgg      2100
     cggggaaaac attcagctgg gggaaagttt gcccagaata tcaaagtaaa tctatcacaa      2160
     gactcgacat actccctgtt ctggtcgcag tcctcgattc agatctggga tgtcagtact      2220
     tgtcccccta ccttcaagga cgccatcacc ccggatggat tcttcatcct tgcggctgtg      2280
     acaggaaccc acgtggccta tatgacagga gaccgagatc gaaagcagac gctgtggatc      2340
     caaagtctcg agcggatgac cacacgtccg gtggagtatc gtgtagggcc cacgccctgg      2400
     tgcaccagca tgaccgtctc ccccagcgga agcttcgtcg ctgtcggatt cgacaaatcg      2460
     accgtcggcc tgttcgcccc ttcagaatgg cagcaaccgc ggctctatcg cgtgcacgct      2520
     cgctatcacc aggactgtaa ggattgtcct ccaattgcca ccgtctcctt ctcccatgat      2580
     gggctcgctc tggtgtgcag cacccgaagc gagcgaaacg gaatgatcca agtgttcttg      2640
     tctcatttcc ccttctccga attccaggag gttttaccct gccggtaccg cgttcctccc      2700
     cctgagtcag aagataacgg gatttcatct gtgctttttc agccggggat aggcggtaag      2760
     gaggacatca tctgcatcac aacatggacg caatccggcg ttcccattct ggtccatcct      2820
     aacggcggcc accgcacgga gatccgtgta cagagttctg cctcgtccaa ccacaaggga      2880
     aaactcggca atcgcatcca ggctgctgcc ttttcgccat cgggacatga gctcgtcctg      2940
     gctaacgata agggctacgt atatcgagta tccaacttga gttctatccc gattgaggtc      3000
     cgaagggttg ctacgtccaa ggagtttacg accaagactg aatcctttgc attggcatac      3060
     gtgcatcaga cggatgaaga cctgattctg gtctcttggt ccgattcatc caaaggagtc      3120
     ggttatgtga ggaaaatccc gatcatgacc acaggggagg tccagcacct tcaagaatca      3180
     aacatcgtca atgccactgt tcatccgagc caaccagaac ttcccgaatt tcagccacca      3240
     gaggagaagg ttcctgagaa acgccagatc ttagtcaagc ctccggtaga gctcgaggct      3300
     tcggagatga gccctccgcc catccaacga ccttcgagaa tgggtctttt cggatcgttg      3360
     cacggtaaga aatag                                                       3375
//

If you have problems or comments...

PBIL Back to PBIL home page