(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE176

ASFUM1_4.PE176       Location/Qualifiers
FT   CDS_pept        complement(830034..833039)
FT                   /codon_start=1
FT                   /gene_family="HOG000171660" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274712"
FT                   /orf_name="AFUA_4G02990"
FT                   /product="Vesicle-mediated transport protein (Imh1),
FT                   putative"
FT                   /protein_id="EAL84447.1"
FT                   /db_xref="HOGENOM:HBG054354"
FT                   /db_xref="HOGENOM:HBG327496"
FT                   /db_xref="InterPro:IPR000237"
FT                   /db_xref="UniParc:UPI000051FFD0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA16"
FT                   /transl_table=1
FT                   /translation="MAHARVLSIEPFEAALRENTPLTSIADPKALTEYLNQITLKGDMV
FT                   IEELKRVTTERDDYKKKLEEAQKSTKEACDAVADLKKDKTQGAKEEKTASTEDTASKKE
FT                   LPAKEESEEFFSFDNELPRLESELKEKQEEVETLKSQVESLKRDLAVARESTEGMVQNL
FT                   ESATRELVELRDIRDKQDSEIKKLKDTRQAEVDDVKAKLAESENTIAKAGEEAEKLKAE
FT                   LKQKTEEIEKLQDQVTQQKDNDQQKELQEKLEEVAKEKDASEKKLGVLQGLVDNLRSQL
FT                   KDTEVVVSDLKADMKGKVEELGKLQNVVDYLNNNLKDNAEWQQTRDQAASGQSPDFDSL
FT                   RKSLAPLQQEPGGGNLATEPEPPANGATGGAGASKKKKNKKKKGGKGGEDTAKATGAAV
FT                   VQDKESHAAESDQAASDLADLEQKIQTLTKQLGDKEAAIDRLSSKLKGEEGLKEEIESL
FT                   RDDLLHLGQDHVEAKDKIKELNVEKKALEETVSKLEKELADIRTSHASKSADSEKMHSD
FT                   LKEDYENLKVKLTNLETELSAAQQLAATRFKDLTELRETLQKLQPELKSLRVESSELKS
FT                   TKEALASKESELRTLEGKHEELRAEVKTLKSTISERDAEVKTLNQKIRQETDSRLKAEE
FT                   NLTVAQSDLRYSESKKQEAVETKEKIAADLSRAQDELKTARSQLREVENKVTQLNKELD
FT                   GLREEIQLKTAQHASAQSLMNSMRDQSAELALQMKEARERCESLEEELADAHRLLSERT
FT                   REGETMRRLLSDIEGRAEAKVRDFKERMEAAIEERDRAEDEASAQGRRRARELEELKTK
FT                   VREAEKALRTAEEDKEELERSQKDWKRRRDQLEEQSERSAQELNDIRQAMARLRDALDE
FT                   SEKQVRDLEKEKAELRRSVEETNSRLEKLRRSYRILSDETRAVQNPQSSRSSIDSGARK
FT                   AVASPVSKDRSPSTRRSETPTGAPIDYIYLKNVLLQFLEQKDKNYQKQLIPVLGMLLHF
FT                   DRSVTYFFNYPN"
     atggcccatg cacgtgtcct gtcgatcgaa ccgtttgaag ccgcgctacg tgaaaacact        60
     cctctgacgt cgattgccga tccgaaagct ctcaccgagt atttgaatca gattacattg       120
     aaaggggaca tggtgattga ggagctcaaa cgagtcacta cggaaaggga cgactacaag       180
     aagaagctgg aggaagcgca gaagtcgaca aaagaggctt gtgatgcggt cgccgatctc       240
     aagaaggaca agacgcaagg cgccaaggag gagaaaaccg ccagtactga ggataccgcc       300
     tcaaagaagg aattaccagc aaaagaagaa agcgaggaat tcttttcgtt cgataatgaa       360
     ctgccccgat tggagtctga gctgaaggag aaacaagaag aggttgaaac tctcaagtcg       420
     caggtcgagt cgctcaagcg tgatcttgcc gttgctcgtg agtcaacgga gggcatggtg       480
     cagaatctcg aatccgcaac tcgcgagctc gtggagttga gagatattag agacaaacag       540
     gattcggaaa tcaagaagct gaaggatacc aggcaggctg aggttgacga cgtaaaagcc       600
     aagctcgcgg aatccgagaa taccattgcc aaggcaggcg aggaggcgga gaaactaaag       660
     gctgagttga agcagaagac cgaagaaatt gagaagcttc aggaccaagt cacgcaacag       720
     aaggacaatg accagcaaaa agagttgcag gaaaagttgg aagaggtcgc caaggagaaa       780
     gatgctagtg agaaaaagtt gggtgtcctc caaggcctcg tggacaacct gcggtctcag       840
     ctgaaagaca cggaagtggt ggtgtcggat cttaaggctg acatgaaagg taaagtcgaa       900
     gagcttggta agctgcagaa cgtggttgat tatctaaaca acaacctgaa agacaacgcc       960
     gagtggcagc aaacgagaga tcaagcggcg agtggacagt cacccgactt tgactccctt      1020
     cgaaagagcc tggcaccgtt acaacaagaa ccggggggtg gcaacctggc tacagagcca      1080
     gagcctccag caaatggcgc gaccggtggc gcgggcgcga gtaaaaagaa gaagaacaag      1140
     aagaagaagg gcggaaaagg cggagaagat acggctaagg ctaccggtgc tgctgtggtc      1200
     caggacaagg aatcgcacgc agcagagtcc gaccaagcag cttcggacct ggccgacctc      1260
     gagcaaaaga ttcagacgct gacaaagcag ctgggagaca aggaggcagc aatcgaccgt      1320
     ctgagctcca agcttaaagg agaggagggc ctcaaagagg aaatcgaatc cttacgcgac      1380
     gatttacttc accttggtca agatcatgtt gaagcaaagg acaagatcaa ggaactgaat      1440
     gtagaaaaga aggcgctaga ggagacggtc tccaagttgg aaaaggaatt agccgatata      1500
     cggacgagcc atgcctccaa gagcgcagac tcagagaaga tgcacagcga tctgaaggag      1560
     gactacgaga acctcaaagt caaactcacc aaccttgaga cggagctctc tgccgctcag      1620
     caactggccg ctaccaggtt caaggatctg acggaattgc gggagacttt gcagaaatta      1680
     caaccagaat tgaagagcct gcgggtagaa tcttcagaac tgaagtcgac gaaggaggcc      1740
     ctggcgagca aggagtctga attgaggaca ctggaaggta aacatgagga gttacgtgcc      1800
     gaagtgaaga ctctcaagtc cacaatttcc gagcgcgacg ccgaggtgaa gaccctcaac      1860
     caaaagatca gacaggagac agacagccgt ctcaaggctg aggagaatct gaccgttgct      1920
     caatctgact tgcgatactc agaaagcaaa aagcaggaag ccgttgagac aaaggagaag      1980
     attgcagcag acttatcccg agcgcaagat gagcttaaga ccgctcggtc ccaactgcgg      2040
     gaggttgaaa acaaggtcac tcaattgaac aaggagcttg atggtctgag ggaggaaatc      2100
     cagctgaaga ccgcacagca cgccagcgcg caaagtctga tgaacagtat gcgcgaccag      2160
     agtgccgagc tagcgttgca aatgaaggag gcccgggaac gttgtgagag cttggaagaa      2220
     gaattggctg atgctcatcg cttgctcagc gagcggacgc gcgagggtga aaccatgcga      2280
     cgcttgctca gcgatatcga gggccgtgcc gaggccaagg tgcgcgattt caaggagcgg      2340
     atggaggccg ccattgaaga gcgcgatcgg gcagaagacg aggccagcgc tcagggtcgg      2400
     cgccgggccc gagagctaga ggagctcaaa accaaggttc gggaagccga gaaagcactg      2460
     agaacggcgg aggaggacaa ggaagagctc gagcgatccc aaaaggactg gaagcgcaga      2520
     cgggatcaac tcgaggaaca gtcggagcgc tcggcgcagg agctaaacga catccgccag      2580
     gccatggcac ggttacgtga tgctttagat gaaagcgaga agcaagtccg tgatctggag      2640
     aaagaaaagg ccgagctgcg tcgttcagtg gaagaaacga acagccgact ggagaagctt      2700
     cgcagatcct accggatctt gtcggacgaa actcgtgcag tccagaatcc tcagtcttcg      2760
     cgttcatcga ttgactcagg agcgagaaag gcagttgcat ctcccgtgtc gaaggaccgt      2820
     agcccatcga cacggagaag cgaaacgccg acgggagcac cgattgacta catctacttg      2880
     aagaacgtgc tcctccagtt cttggaacaa aaggataaga actaccagaa gcagctgatc      2940
     ccagtcttgg gtatgctgct tcatttcgat cggtcagtaa cctatttctt taactacccg      3000
     aattga                                                                 3006
//

If you have problems or comments...

PBIL Back to PBIL home page