(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE181

ASFUM1_4.PE181       Location/Qualifiers
FT   CDS_pept        join(848943..848984,849099..849395)
FT                   /codon_start=1
FT                   /gene_family="HOG000035939" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274717"
FT                   /orf_name="AFUA_4G03040"
FT                   /product="Got1 family protein"
FT                   /biological_process="vesicle-mediated transport "
FT                   /protein_id="EAL84452.1"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="HOGENOM:HBG204028"
FT                   /db_xref="HOGENOM:HBG592905"
FT                   /db_xref="InterPro:IPR007305"
FT                   /db_xref="UniParc:UPI000051EC6D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA11"
FT                   /transl_table=1
FT                   /translation="MYHSGLYFESLQANILFLIGLTLIIGVQRTLAFFSRRQKLKGTAA
FT                   FAAGILLILFRWPLTGFLIELYGLFILFGDFLVTIGQFAGNIPVVGPYIKTALETLAGG
FT                   RRNAELPV"
     atgtatcatt ctggtctata ctttgagagc cttcaggcta acatcctttt cctcatcggc        60
     ttgacgttaa tcattggagt tcaacggaca ctcgctttct tttcgcgccg ccaaaaactt       120
     aagggcactg ccgctttcgc ggcaggcatc ctcctcatcc tgtttcgctg gccactgaca       180
     ggtttcctga tcgaattata cggtctcttc atcctcttcg gcgatttcct cgtaacaatc       240
     ggtcaatttg cagggaacat cccggtcgtc ggtccttata tcaagacggc attagagacc       300
     ttggcgggtg ggagacggaa cgcagagctc ccggtataa                              339
//

If you have problems or comments...

PBIL Back to PBIL home page