(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE183

ASFUM1_4.PE183       Location/Qualifiers
FT   CDS_pept        join(853078..853995,854051..854962)
FT                   /codon_start=1
FT                   /gene_family="HOG000171570" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20753603"
FT                   /orf_name="AFUA_4G03060"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84454.1"
FT                   /db_xref="HOGENOM:HBG054356"
FT                   /db_xref="HOGENOM:HBG327505"
FT                   /db_xref="UniParc:UPI000051F646"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA09"
FT                   /transl_table=1
FT                   /translation="MARGILGRSRAPEAIEIISNPGLKYSDAIPRTDLRDVKSVANNSR
FT                   PVNRAVAQWNFQRPRTADGRQPIKKGQGVNPGFDFQIAIPPAEAVPLPKSPDDDINANM
FT                   IGIALGSPRMAEPQRILPQMQEQPPVSTSASPEQVSPQTKTLKRKPSKWRKIGGLFKAK
FT                   NAFPATANQPFYQLRCAEEWPLQESTHSVDYKHQQEAAKSEPENATPQNLPNLEKWPCL
FT                   EGKDESKSCVQSSSETVPQESVKNIDLASGTKLRTAGPFLQIDIPDVQLERYSVMFGGV
FT                   LNQNTPSLLKRRSKTLEDVRIPKPDASIPPPDFQSPRRRATSPQPRLPSFNLFPTQAPV
FT                   SKASRVLGSQNIPRGPSPLHRSQTSLSGIGRQTPTNDPNHDLLVVQSPSIKSPMLHQTK
FT                   DSVSSTVSMDSTEEQRLLQKLKQTKIYVDKEQEPEWEIINKKPTSKGLSPRPSPIQNPT
FT                   PSPRQRTPPLALKINTQVLPSTTSSISSAPSPHLSPINSAARDKPERNRSPVETLSAVF
FT                   PFSATRMPLSDDTEDIEAKEAMDPIPKVEVSIARSVSVSRGKKQVIVPIRPRAGRLNPN
FT                   ERLVVRQAKTPQVRDAQHGHRHGISQDVRIETI"
     atggctcgag gcatcttagg gaggtcgcgc gcaccagagg cgatagagat catttcgaac        60
     ccgggtttga agtattccga cgcaatacca cggacagatc tgagagatgt caagagcgtg       120
     gccaacaaca gccgccctgt aaaccgcgcc gttgcgcaat ggaactttca gcgccctagg       180
     acagcagatg gacgtcagcc gatcaagaag gggcaaggtg tcaatcccgg tttcgacttt       240
     cagatcgcca tacctcctgc ggaagcagtg cctttaccca agagccctga tgacgatata       300
     aatgcgaaca tgattggcat agccttaggt agccctcgca tggcagaacc gcagcgtata       360
     ctcccgcaaa tgcaagaaca gccgcccgtt tcgacttcgg cgagccccga acaagtctct       420
     ccccaaacga aaaccctcaa gcgcaaaccg agcaaatgga ggaagattgg tggattgttc       480
     aaggccaaga atgcatttcc agctacggcc aatcagccat tctatcagct tcgctgtgcc       540
     gaggagtggc ctctacagga atccacccat tcagttgact acaaacacca acaggaggct       600
     gcaaaatcgg aacctgagaa cgctacgcct caaaatcttc caaatttaga gaaatggccg       660
     tgtcttgagg gaaaggatga atccaaatcc tgcgttcaaa gcagctcgga gacggttcct       720
     caagagtcag tcaagaatat tgaccttgca tctggtacaa agcttcgcac tgcaggacct       780
     tttctgcaaa tcgacattcc tgatgtccag ctagaaaggt atagcgtcat gtttggtggt       840
     gttttgaatc aaaacacgcc ctcgttgttg aagaggcgga gtaagacatt ggaggatgtg       900
     aggatcccaa agccagatgc atccatacca ccaccggact ttcagtcacc tcgacgacgg       960
     gcgacatcgc cgcagccacg acttcccagc ttcaatctgt tccccactca agcgcctgtc      1020
     agtaaggcgt cgagggttct gggctctcag aatattccaa gaggccccag ccctttgcat      1080
     cgaagccaaa catcgctctc tggaataggc cgacagacac ctacaaatga tccaaatcac      1140
     gacctactgg tggtgcagag tccatccatc aagtccccaa tgttgcatca aaccaaggac      1200
     tccgtatcat cgacagtgtc aatggattca accgaggaac agcgccttct gcagaaactc      1260
     aaacagacga aaatctacgt ggacaaagag caggagcctg aatgggaaat tatcaacaag      1320
     aagccgacaa gcaagggcct aagtccacgt cctagcccta tccagaaccc aactcccagc      1380
     ccaaggcaga gaacaccacc cttggcccta aagatcaaca cccaagtctt gccatccacg      1440
     acgtccagca taagctccgc cccatccccc cacctctcac ccatcaactc cgccgcgcgc      1500
     gacaagcccg agcgcaacag atctcccgtg gaaactctgt ccgcagtctt ccccttctcg      1560
     gccacacgca tgcccctcag cgacgatacc gaggacatcg aagcgaagga ggccatggac      1620
     cccatcccta aggttgaagt ctccatcgcg agatccgtct ccgtctcgcg aggaaagaag      1680
     caggtcatcg tacccatcag gccaagggcg gggagactga atcctaacga gaggctcgtt      1740
     gtccgacagg cgaagacccc acaggtacgg gacgcgcagc acggccaccg gcatggaatt      1800
     tcacaggacg tgcgcatcga aactatctag                                       1830
//

If you have problems or comments...

PBIL Back to PBIL home page