(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE188

ASFUM1_4.PE188       Location/Qualifiers
FT   CDS_pept        join(complement(870156..870249),complement(869987..870094),
FT                   complement(869386..869926),complement(868474..869317))
FT                   /codon_start=1
FT                   /gene_family="HOG000167080" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19905741"
FT                   /orf_name="AFUA_4G03110"
FT                   /product="MFS monosaccharide transporter, putative "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL84459.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG330944"
FT                   /db_xref="HOGENOM:HBG534647"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051E59C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WA04"
FT                   /transl_table=1
FT                   /translation="MAPSYAGMSGRPLSLTVSTIATMGFLLFGYDQGVMSGIISDNAFA
FT                   KVFTATKDDATMQALVTAVYELGCLVGAIFALFFGDRTGRRWMIFSGAIVMIVGVIIQV
FT                   TSFVGHIPLLQFFIGRVITGIGNGMNTSTIPTYQAECSKTSNRGLLICIEGGVIAIGTA
FT                   IAYWIDFGAHYGPDDLVWRFPIAFQIFFGLIIIIGMFFLPDSPRYLISKDRIQEGEYVL
FT                   AALAGREVHDHETQIQKQSVIESIRASGSAQKTRFRDLITGGRTQHFRRMLIGSSSQIF
FT                   QQLGGCNAVIYYLPVLLKESLHQSNDMALLIGGINMIVYSLFATFSWFFIEKIGRRKLF
FT                   LGGSFLQTISMVITFACLIPGDEQTSKGAVFGLFLYMAAFGAAWLPLPWLYPAELSPIK
FT                   TRAKANAVSTCSNWLFNFTVVMITPVMVAHIGWGTYLLFAALNASFIPVIWLFYPETAN
FT                   RSLEEIDLIFTKGYVENISYVKAARELPKLIDDEIEAKAAEYAFASGDSLDEIEKAHAE
FT                   HNAAQRLETTQ"
     atggcgccct catatgccgg catgtcaggc aggccactgt cgctgactgt atcgactatt        60
     gccacgatgg gtttcctact ctttggatat gaccagggtg tcatgtctgg tatcatcagt       120
     gacaatgctt ttgccaaggt ctttacagct accaaagatg atgctactat gcaagctctt       180
     gtgaccgctg tatacgaact tggttgcttg gtgggtgcta ttttcgccct ttttttcggt       240
     gatcgcactg gccgtcgctg gatgatcttc tcaggcgcta tcgttatgat tgtcggtgtc       300
     atcatccagg ttacttcatt tgttggacac atcccccttc tgcagttctt tattggccgt       360
     gtcatcaccg gtatcggaaa cggaatgaac acttctacca ttcctacata ccaagccgag       420
     tgctccaaga caagtaaccg tggtctcttg atctgtatcg agggtggtgt gatcgccatt       480
     ggtaccgcca ttgcatactg gattgatttc ggcgctcact atggccccga tgaccttgtc       540
     tggcgtttcc ccattgcgtt ccagatcttc tttggtctaa ttattatcat cggaatgttc       600
     ttcctgcccg actcccctcg ctaccttatc tccaaggatc gcatccaaga gggagagtac       660
     gtccttgctg cgctggcagg ccgcgaggtc cacgatcatg aaacccagat tcagaaacaa       720
     tcggtcattg agtccatcag agcttctggt tccgctcaga agacaagatt cagagatctt       780
     atcactggcg gccgcaccca acatttccgc cgtatgctca tcggctcctc ttcccagatc       840
     ttccagcagc tcggcggttg caacgctgtg atttactatc ttcctgtctt gttgaaggag       900
     tctctgcacc agagcaacga catggccttg ctgatcggag gcattaacat gattgtgtac       960
     tccctcttcg ccaccttctc atggttcttc atcgagaaga ttggtcgtcg caagcttttc      1020
     cttggaggct cattccttca gactatctcg atggttatca catttgcttg cttgattcct      1080
     ggcgatgaac agacttccaa gggtgctgtt ttcggtcttt tcctgtacat ggccgccttc      1140
     ggtgctgcgt ggctgcctct gccctggctg tatcccgccg aattgtctcc catcaagacc      1200
     agagccaaag ccaacgctgt ctctacttgc agcaactggc tctttaactt tactgttgtc      1260
     atgatcactc ctgtcatggt tgcgcacatt ggctggggta cctacctgtt atttgctgcg      1320
     ctgaacgcct cgttcattcc cgtcatctgg ctcttctacc cagagaccgc caatcgcagt      1380
     ctggaggaga tagatttgat cttcaccaag ggctacgtgg agaacattag ctatgtgaag      1440
     gctgcgagag agcttcccaa gcttatcgac gatgaaattg aggccaaggc ggcagagtat      1500
     gctttcgcct ccggtgactc tcttgacgag atcgagaagg ctcacgctga gcataatgct      1560
     gcccagcgat tggagacgac ccagtga                                          1587
//

If you have problems or comments...

PBIL Back to PBIL home page