(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE194

ASFUM1_4.PE194       Location/Qualifiers
FT   CDS_pept        join(885891..886078,886139..886514)
FT                   /codon_start=1
FT                   /gene_family="HOG000171515" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16274724"
FT                   /orf_name="AFUA_4G03170"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84465.1"
FT                   /db_xref="HOGENOM:HBG054363"
FT                   /db_xref="HOGENOM:HBG327434"
FT                   /db_xref="UniParc:UPI000051FB3C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9Z8"
FT                   /transl_table=1
FT                   /translation="MVDMASETVVNSDLRRAGTEAKRQHDRKAKWAYGGRCALPRQNLV
FT                   APFLPITRPAKPLHRHLPAIKRSNQHSLNQLARYSRVSLHHDIQEMLDTGTSDSSSGEE
FT                   VEESVAVEKDPEVMIVDQDETVHPYEVAGQTILSDAVNKAVEKYETKETEKLVKEYEIV
FT                   SHESEMGTGYLADDDFELVDHVQL"
     atggtcgaca tggcatccga gactgtcgtc aacagtgatc tgcgacgggc aggtaccgaa        60
     gcaaagagac agcacgatcg caaggctaaa tgggcttacg gtggccgatg tgcgcttcct       120
     cggcagaacc tggtggcccc ttttctgcca ataacgcgtc ctgcgaaacc gctgcaccgt       180
     catcttcccg ccatcaagcg ttcgaaccaa cacagcctca accagctcgc gcgttattcc       240
     agggtttccc tgcatcatga tatccaagag atgctcgaca caggcacctc tgattcctct       300
     agtggtgagg aagtcgagga gtcagtcgcg gtcgaaaagg accccgaagt catgatcgtt       360
     gaccaagacg aaaccgtcca tccatatgag gtggcaggtc agacgatctt gtctgacgca       420
     gtgaacaagg ccgtagagaa gtacgagaca aaggagaccg agaagctggt caaggaatat       480
     gagatcgttt cacatgagag tgagatggga actggctatc tggctgacga tgatttcgag       540
     ctggtagacc atgttcagct gtga                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page