(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE196

ASFUM1_4.PE196       Location/Qualifiers
FT   CDS_pept        join(889865..890159,890226..890592,890644..891017,
FT                   891087..891429,891481..891529)
FT                   /codon_start=1
FT                   /gene_family="HOG000191477" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16258988"
FT                   /orf_name="AFUA_4G03190"
FT                   /product="Alpha,alpha-trehalose-phosphate synthase subunit,
FT                   putative"
FT                   /EC_number="2.4.1.15"
FT                   /function="alpha,alpha-trehalose-phosphate synthase (UDP-
FT                   forming) activity"
FT                   /biological_process="trehalose biosynthetic process "
FT                   /protein_id="EAL84467.1"
FT                   /db_xref="GO:0003825"
FT                   /db_xref="GO:0005992"
FT                   /db_xref="HOGENOM:HBG287181"
FT                   /db_xref="HOGENOM:HBG559076"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="UniParc:UPI0000520906"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9Z6"
FT                   /transl_table=1
FT                   /translation="MAPDSSQVKRNLIIVSNRLPVSVKRTDGSYKSSLSSGGLVTSLSG
FT                   LTKSTEFRWFGWPGLDVTEKKDRELVAQSLDEHNAVAVFLDANLANEHYNKFSNSILWP
FT                   ILHYQSGVVYDDGPWQAYRRVNELFADAVAEAATRGSLIWVHDYHLMLLPKLLRQRLNK
FT                   EKPCAIGFSLHTPFPAGDFWRALPVRNDLLEGMLASDLIGFHTDEYKSNFIQTCAQVLG
FT                   ARTEIPGRIQYKDRLVETDKFIVGIDPQKFKDTLQKQEVQDRIKQLEEKYKGITVIIGV
FT                   DRLDYIKGLTQKLKGYDHFLDRHPELRNKVILIQVAVPSREDVKEYQELETELSTIAGK
FT                   INGKHSTPDGVPLLYMHRSVPFTELTALYSIADACLLTSTRDGMNLVSFEYIACQEQRH
FT                   GVLVLSEFAGAASFMKEGSISFHPANTTELADAVYKAVMMGEDEKKKKYEYLRNFIETN
FT                   TSARWGETFIDRLSKHI"
     atggcgcccg acagttcgca agtgaagcgc aacctcatta ttgtttcgaa tcgccttcct        60
     gtctcggtca aacggaccga tggctcatat aagtctagtc tgtctagcgg tggtctggtc       120
     acatcgctat ctgggttgac aaaatccact gaattccgct ggttcggttg gcctggtcta       180
     gatgtcactg agaagaagga cagagagtta gtagcccaga gtctcgatga gcataacgca       240
     gtcgcagtct tcctggatgc gaatcttgcg aatgaacact ataacaagtt ctcaaactca       300
     atcctctggc ctatcctcca ctaccagtct ggggttgtct acgacgatgg tccatggcag       360
     gcctatcggc gtgtcaatga gctgtttgca gatgctgtag ctgaggcagc tacaaggggg       420
     agcttgattt gggttcatga ctatcatctc atgctcctcc cgaagcttct gcgtcagcga       480
     ctcaacaaag aaaaaccatg cgctattggg ttctccttac atacgccatt tccagcggga       540
     gatttctgga gagcgctacc tgttcgaaat gatctgctcg agggaatgtt ggccagtgac       600
     ctgattggat tccacacgga cgagtacaag tcgaacttta tccagacttg tgctcaggtt       660
     ttaggcgctc gaacagagat acccggtcga atccagtaca aggatcgatt agtcgagaca       720
     gataagttca ttgtcggaat cgatccgcaa aagttcaagg atacgttgca gaagcaagag       780
     gtgcaggatc ggatcaagca gctggaggag aaatacaagg ggattacggt catcattggg       840
     gtagaccgac tggactacat caagggcctt acgcagaagc tgaagggata cgaccacttc       900
     ctggatcgtc acccagagtt gaggaacaaa gttatcttga tacaggttgc tgtcccaagt       960
     cgcgaggatg tcaaggaata ccaggagttg gagacagagt taagtacaat tgcagggaag      1020
     attaatggaa aacattccac tcctgacgga gttccgctcc tctacatgca tcgctctgtt      1080
     cccttcaccg agctaacggc gttatactcg attgctgatg cttgccttct tacatctact      1140
     cgcgatggga tgaacctcgt gtcgtttgaa tacattgcct gtcaggaaca acggcatggc      1200
     gtcctggtgc tctctgaatt tgcgggagca gcttccttca tgaaagaggg aagtatcagt      1260
     ttccaccccg caaacacaac ggaactggca gatgctgtct ataaagctgt gatgatgggc      1320
     gaggacgaga agaagaagaa atacgagtac ctgcggaact tcatcgagac taatacaagt      1380
     gctcgatggg gggagacttt cattgacagg ctgtccaaac acatctaa                   1428
//

If you have problems or comments...

PBIL Back to PBIL home page