(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE197

ASFUM1_4.PE197       Location/Qualifiers
FT   CDS_pept        join(896022..896301,896353..896570,896645..896885,
FT                   896935..897545)
FT                   /codon_start=1
FT                   /gene_family="HOG000171493" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20749747"
FT                   /orf_name="AFUA_4G03200"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84468.1"
FT                   /db_xref="HOGENOM:HBG054366"
FT                   /db_xref="UniParc:UPI000051FB3D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9Z5"
FT                   /transl_table=1
FT                   /translation="MKFTAFSLLSLACAAVASREGEAAMDRLMSVKVEERERFRAEGLF
FT                   DANQYPDLGSQKCVNGKAGEYSCENVDLLGFLSHQAMGSKTREGNDIWGWTSPDGREFG
FT                   IIGQTDGTAFVEVHADGSLDYVGRLPTQTQSSVWRDMKVIGDHVYIGSEAPGHGLQVFD
FT                   LKKLLRTDPSKPTTFSISRDLTAWYNAFGSSHNIVAHEETNMIYAVGTTRSHSCAGGLW
FT                   MVDVSNPAKPISPGCVNQDGYVHDAQCVIYKGPDKKYNGREICFNYNEDSLTIVDVSNK
FT                   KSPVQISKTPYAGSSYTHQGWVTDMEDMSYLLLDDELDEKDGTGVAANGHTTTYVFDIR
FT                   NLAKPKHTGTYQSPVKSIDHNQYVLNGLSYMSNYSSGLRIVDVRSVTQDPTGAKFKQVG
FT                   FFDCHPDDDAEGGKVQFVGSWSVYPYFKSGNILLNSIERGVFSLKYTGPK"
     atgaagttca cagccttctc actgttgtcc ctggcatgtg ctgctgtggc ctcccgagaa        60
     ggggaagcgg ccatggaccg cctcatgtct gtcaaggtcg aggagagaga gagattcagg       120
     gctgaaggtc ttttcgatgc caaccagtat cctgatttgg gaagtcagaa gtgcgtcaat       180
     gggaaagcag gagagtattc gtgtgagaat gtcgaccttc ttggcttcct cagtcatcag       240
     gctatgggca gcaagacccg tgagggcaat gacatctggg gatggacttc gcctgatggt       300
     cgtgaatttg gcatcattgg tcaaaccgat ggcacggctt tcgttgaagt gcatgcggat       360
     ggaagcctcg attacgtcgg acggctacca actcagacac agtctagcgt gtggagagac       420
     atgaaggtta ttggcgacca tgtctacatt ggatcggagg ctcctggtca cgggctccag       480
     gtgtttgatc tgaaaaagct cctgcgcacg gatcctagta agcctaccac attctcgatt       540
     tctcgcgatc tcacggcctg gtacaacgct ttcgggagct ctcacaatat cgtcgcccac       600
     gaggagacga acatgatcta cgcagttgga acgactaggt ctcatagctg cgctggaggc       660
     ctgtggatgg tggatgtttc caatcccgcg aaaccaatat cacccggctg tgtgaaccag       720
     gacggctatg tgcatgacgc acaatgtgta atctacaagg ggcccgacaa gaagtataac       780
     ggacgcgaga tctgcttcaa ctacaacgag gattcgctga ccatcgtcga tgtctccaac       840
     aagaaatccc cggtgcaaat ctccaagact ccctacgctg gctctagcta cactcatcag       900
     ggctgggtta ctgacatgga ggacatgtcg tatctgctgc ttgatgacga gctcgacgag       960
     aaggacggca ctggagtggc cgccaacggg catactacaa cctatgtctt tgacatccgc      1020
     aatcttgcca aacccaagca tactggaacc taccagtccc ccgtcaaatc gatcgaccac      1080
     aaccaatacg tgctcaacgg cctctcttac atgtccaact acagcagtgg cctgcgcatc      1140
     gtggatgtca gatctgtcac tcaggatccc actggtgcca agttcaagca ggttggcttt      1200
     tttgactgcc accctgatga tgacgccgaa ggtggcaagg ttcagtttgt tggaagctgg      1260
     agcgtttatc cttacttcaa gagcggcaac attctcctga acagcattga acggggtgtt      1320
     ttctctttga agtacactgg gcctaagtga                                       1350
//

If you have problems or comments...

PBIL Back to PBIL home page