(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE202

ASFUM1_4.PE202       Location/Qualifiers
FT   CDS_pept        join(complement(919374..919566),complement(919300..919319),
FT                   complement(919113..919247))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206304"
FT                   /orf_name="AFUA_4G03250"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84473.1"
FT                   /db_xref="HOGENOM:HBG054369"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="UniParc:UPI00005201F9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9Z0"
FT                   /transl_table=1
FT                   /translation="MEAEEAARDLLRAIFVTPSQKVSEKYIEAVIDAAVSFTVNVVPTG
FT                   SLSRTRALARAYTLIFIHDDAVESGNFDATIPNMCNNNERHSHTAFDMVAQEVMSEDTA
FT                   QGRRFLDGMMS"
     atggaagcgg aagaggctgc gagagatttg ctacgggcga tctttgtcac cccgtcacag        60
     aaagtctctg agaagtacat cgaagctgtg attgatgccg ctgtctcgtt cactgtgaat       120
     gttgtcccaa caggaagttt atcgagaacg agagctctgg caagggctta tacgcttatc       180
     ttcatacatg atgatgctgt tgagtcggga aatttcgatg caaccattcc gaatatgtgt       240
     aacaataatg agcgacattc tcacactgca tttgacatgg tagcccagga agtcatgtct       300
     gaggacactg cgcagggcag gagatttctg gacggtatga tgtcgtga                    348
//

If you have problems or comments...

PBIL Back to PBIL home page