(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE207

ASFUM1_4.PE207       Location/Qualifiers
FT   CDS_pept        join(937257..937464,937576..937988,938035..938545,
FT                   938595..938668)
FT                   /codon_start=1
FT                   /gene_family="HOG000171392" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206305"
FT                   /orf_name="AFUA_4G03310"
FT                   /product="C6 finger domain protein, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL84479.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG054375"
FT                   /db_xref="HOGENOM:HBG326851"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR002409"
FT                   /db_xref="UniParc:UPI0000520451"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9Y4"
FT                   /transl_table=1
FT                   /translation="MSQMRSSPYSTHANKEKQKAPLRKKACQNCTKSKVRCGLEKPICS
FT                   RCRSKGHSCQYPPGRVAAPQIGVTAAASRSPRPRAVTSGQTRRLDLDFTDIDLTPSLNA
FT                   VDIRDRWLRPYLLPPLGRDEILKAYHLFTLQYISITLRTYPQYMVKDGGFPPIIHHTQV
FT                   NTNQMPQALANCYSLVRMWVQAAPGSETMVMSAVEAEMERLASETTSQHDYDLLCSFQA
FT                   YLVYTILMYFSPLGNVSAVTDKIMMTLMELAFRTAQNGLLCTAETTHTRPNWESWIVVS
FT                   AKRRAIYTMYLLTSVYNSDRGLPNFVADEMKGVYVPESKVLWEVTDREVWEKEYDRHLL
FT                   EWEDGMLEISELWRSTETGSTERRERIGRWVRGVDEFVPTEFRRAPSELRNRQASTLCG
FT                   ST"
     atgagtcaaa tgagatcatc tccatacagc acacatgcga acaaagaaaa acagaaggct        60
     cctctgcgga aaaaggcatg tcagaattgc accaaatcca aagtacgatg tggactagaa       120
     aagcctatct gttcgcgatg caggtcgaaa ggccacagct gccaatatcc cccggggcgc       180
     gtcgctgcac ctcagattgg ggtcactgct gcggcttcca ggtctcctcg tcctcgtgct       240
     gtaaccagcg gacagaccag acgcctcgat ctcgatttta cggatatcga cttgacaccc       300
     agtctaaatg cagtagatat tcgagaccga tggctgagac cgtatctcct cccacctcta       360
     ggacgagacg agattctcaa ggcctaccat ctatttacgt tgcaatacat ctccattacg       420
     ctcaggacat atccacagta tatggtcaag gatggcggtt ttccgccaat tatacaccat       480
     acacaagtca atacgaatca gatgccacaa gctctggcca actgttacag cctggtccgg       540
     atgtgggtgc aagcggctcc aggaagcgag acgatggtga tgagcgctgt cgaggcggaa       600
     atggaaagac tggcaagtga gacaacgagt caacatgact acgacctctt atgttccttc       660
     caagcctacc ttgtctatac catcttgatg tacttcagcc ctctcggcaa tgtatctgca       720
     gtaaccgata aaatcatgat gaccttaatg gagcttgcct tccgtactgc tcagaatggc       780
     ctattgtgta cggcggagac cactcatacg cggccaaatt gggaatcttg gatcgtggtc       840
     tcggccaaac gtcgcgccat ttacaccatg tacctactca ccagtgtcta caattcggat       900
     cggggtctac caaactttgt ggccgacgaa atgaaggggg tctatgtccc cgaaagcaag       960
     gtactatggg aagtcacaga ccgagaagta tgggaaaagg agtatgaccg ccacctcctg      1020
     gaatgggaag atggaatgct ggaaatatcg gagttatggc gatcaaccga gactggctcg      1080
     actgaacgac gggaaaggat tggaagatgg gttcgtgggg tggacgagtt tgtccctacg      1140
     gaattccgaa gggcaccatc ggagctccgg aatcggcagg cgtcaacctt gtgcggctca      1200
     acataa                                                                 1206
//

If you have problems or comments...

PBIL Back to PBIL home page