(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE212

ASFUM1_4.PE212       Location/Qualifiers
FT   CDS_pept        join(949509..949605,949678..949831,949883..950171,
FT                   950217..951866)
FT                   /codon_start=1
FT                   /gene_family="HOG000171344" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055107"
FT                   /orf_name="AFUA_4G03330"
FT                   /product="Plasma membrane stress response protein (Ist2),
FT                   putative"
FT                   /protein_id="EAL84482.1"
FT                   /db_xref="HOGENOM:HBG054352"
FT                   /db_xref="HOGENOM:HBG327420"
FT                   /db_xref="InterPro:IPR007632"
FT                   /db_xref="UniParc:UPI000051EA4B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9Y1"
FT                   /transl_table=1
FT                   /translation="MALLFFHNHQFEHAELDNLGVDWVIHYQFEEVDTYQAVEVFQNLI
FT                   HNLKAAQLQIQVRHGYGSSLLVCVRVPRDHLGRMIYESRVKDWLYGIVHELPVASDHAV
FT                   AETPAEELRSVYHAVTWQRHLGGAGITPGIGQWKNIASAFPLHDQAANAELLRNMSRSL
FT                   TLTDKDLDAIRALFGEKTAFYFAFIHSYSSFLVVPAVWGIICWSYFGPYSVNCAVVNCL
FT                   WCIVFVEYWKIRETDLSLQWNVKGVGALKVNRPQYVWDKEIQDPITGETVRVFSMRKQL
FT                   LRQLLLIPFATVAAVALGSLIVVTFALEVFISEVYVGPLKGYLEFLPTVLFSLSLPTIT
FT                   SKLTDIATQLTEYENYRTQDQYDLAQTAKTFVMNFITAFLPTLLTAFVYVPFGAKIIPY
FT                   LDVFHVRGLHSSISTEFQVDTSRFQQEVIYLSVTGQVVSFGEEVILPYVKKVIWRKWRD
FT                   YRLQKTQAGRPRRHSKMTDLLLIDSPSEAAFLTRIRNEAEADEYNVHEDTLEMCVQYGY
FT                   LALFGVAWPLVPLLFLINNWLELRGDFFKLTLECQRPPPIRADSIGPSLQGLEFLTWLG
FT                   TLSTASIVYLYRDGMKEVHMSSLLLVLFIAQQVYLAVRFAVRTGLQKLGSGTLRREAAK
FT                   RYAVRKSYLEKFCARRTHGNGKPRVRFNDHVDVYSSSTDSSPTEALETKSATLHQETAY
FT                   ASEREEEFWEGQRWTAEEVGVKLIKALSGEEKKRE"
     atggctcttc ttttcttcca caatcatcag tttgagcatg cggagcttga caatcttggt        60
     gtcgattggg tgatccacta tcagttcgaa gaagttgaca catatcaagc agttgaggtg       120
     ttccaaaatt tgatccacaa tcttaaagca gcacaactcc aaatccaagt cagacatggt       180
     tatggctcct cgctgctggt ctgtgtccgg gttccccggg atcacttggg acggatgata       240
     tacgagtcga gagtaaaaga ctggctatat ggaatcgtcc atgaactccc cgttgcaagc       300
     gaccacgccg tggccgaaac ccccgccgaa gaactccgat cagtctacca tgctgtaacc       360
     tggcagagac acctgggtgg tgctggcatc accccaggaa taggacagtg gaagaacatt       420
     gcgtctgcgt ttccgcttca tgaccaggcc gctaacgccg agctgctgcg taatatgagt       480
     cgatcattga cgttaactga taaggatctg gatgcgatcc gtgccttgtt tggcgagaag       540
     acggcgtttt actttgcgtt tatccattct tattcgtctt ttctggttgt gccagccgta       600
     tggggaatca tttgctggtc atatttcggt ccatactctg tcaactgcgc agtagtcaac       660
     tgtctttggt gcatcgtttt tgtcgagtac tggaagatcc gcgagacaga cttgagcctg       720
     cagtggaatg tcaaaggggt tggagcgcta aaggtcaacc ggccgcagta tgtctgggac       780
     aaggagatcc aggacccgat cacaggagaa accgtgcgcg tattctccat gcgaaagcag       840
     cttctgcgcc agttgttgct tatccccttt gctacggttg ccgctgtagc gctcggcagc       900
     ttgatcgtcg tcacctttgc cctggaagtt ttcatctcgg aagtttacgt gggcccgctc       960
     aaggggtatc tggagtttct tccgactgtg ctgttttctc tctcgctgcc gacaatcacc      1020
     tcgaagctga cggacattgc cactcaactg acggagtatg agaattaccg cacacaggat      1080
     cagtatgatc tggcccagac ggcaaagaca ttcgtgatga atttcattac cgcgttccta      1140
     ccaactctgt tgaccgcgtt cgtctacgtc ccttttggtg cgaagatcat cccttacctg      1200
     gacgtcttcc atgtcagggg cctccattcc tctatatcca ctgaattcca ggtggacacc      1260
     tcccgcttcc agcaggaagt aatctacctg tcggtgacag gccaagtcgt aagcttcggc      1320
     gaggaggtca tcctcccgta cgtgaaaaag gtcatctgga gaaaatggcg cgactaccgc      1380
     ctccagaaaa cgcaagctgg ccgcccacgc cggcactcca aaatgaccga ccttcttctg      1440
     atcgactcgc cctccgaggc tgcgttcctt actcggatcc gcaacgaagc cgaagcggac      1500
     gagtacaacg tccacgaaga tacgctggag atgtgcgtgc agtacgggta cctcgccctt      1560
     ttcggggtcg cctggccgct cgtccctctc ctcttcctga tcaacaactg gctcgagctg      1620
     cgcggtgatt tcttcaagct caccctcgaa tgccagcgcc cgccacccat ccgcgcggac      1680
     tcgattggcc cgtctctcca aggcttggag ttcctgacat ggctcggcac cctctcgacg      1740
     gcaagtatcg tctatctcta ccgcgacggg atgaaagagg tccacatgtc ctccctgcta      1800
     ctggtcctgt tcatcgctca acaggtatac cttgcggtgc gctttgccgt acgcacggga      1860
     ctgcagaagc tcggctcagg tactctccgc cgcgaagccg ccaagcgcta cgccgtgcgg      1920
     aagtcctacc tggagaagtt ctgtgcccgg aggacgcatg ggaacgggaa gccgcgggtg      1980
     cggttcaatg accatgtgga tgtgtacagt tcctcgacgg actcgtcccc gacagaggct      2040
     ctagaaacca agtcggcgac gctccatcag gaaacagcct atgcaagtga acgagaggag      2100
     gaattttggg agggacagcg ctggacggcg gaggaggtgg gtgtgaagtt gatcaaagcg      2160
     ttgagtggag aggagaagaa gcgagagtag                                       2190
//

If you have problems or comments...

PBIL Back to PBIL home page