(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE213

ASFUM1_4.PE213       Location/Qualifiers
FT   CDS_pept        complement(952507..955101)
FT                   /codon_start=1
FT                   /gene_family="HOG000171322" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16258995"
FT                   /orf_name="AFUA_4G03340"
FT                   /product="DUF1212 domain membrane protein "
FT                   /protein_id="EAL84483.1"
FT                   /db_xref="HOGENOM:HBG124694"
FT                   /db_xref="HOGENOM:HBG324120"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="UniParc:UPI000051FB42"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9Y0"
FT                   /transl_table=1
FT                   /translation="MSDSRQGSESSAATYHSQPESENTQDSVGPESPGSPPAPPGSPRS
FT                   PEQQSQDGDNQEIPNIETTPKSGENGEGSQKRQRVRFRSAISVDYPQPGGPESSEDERS
FT                   IQEKQKAQRDQAQRQGQPHLMSTPYVHGSLDVTETPLKERTTQEDLQQAEKTPVDKKPD
FT                   GIGAAAAVGDVSRTAKDKLRWLWDTVHGKLSKWSDRLGRPERGGDDLGPGVYHNEWTSG
FT                   GNAPLGDLTDNKHKTHEEKKSHQATSTSEAHRLVRELTQDQSGNRRKTRGKPYPHTDTQ
FT                   GGQGGQGNNAIESGLRYRAGGGGVLAQLMKLNGGMQQGGQAGQAGQGGQRSPSDTGTSG
FT                   TTTPKKEKLKWYKNKQHTRSTSTLVGASGSMSGASTPVSSEVLSAASKRLGGQQFQQGG
FT                   RMRLEDEIQVTVQIAEIIARQRYIMQLCKALMTFGAPTHRLEEYMQMTAKVLEVDSQYL
FT                   YFPGCMIMSFDDPSTRTTEVKLVRVAQGINLQKLANTHRIYKNVVHDVIGVEEAIQELE
FT                   DIQKKPPRFNKWIVVLVYGLASATVGPFAFNARPIDMPIIFFNGCLLGLMQQVFAPRSA
FT                   LYSNVFEVTAAVLTSFLARAFGSIPKAVIDGKRQFLFCFSAIAQSSIALILPGFLVLCS
FT                   SLELQSHQIIAGSIRMVYAIIYSLFLGYGITVGTTIYGLMDPSAVSDIQCPKAGAFKNP
FT                   YLQRFPFVAIMTVWLLIINQGKWKQLPVMSTIAMSGYITNYFSTKRLGSNSQVANTVGA
FT                   FTIGIMGNLYSRLWHGHAATAILPAILVLVPSGLAASGSLITGVASADQIRHNISSPSG
FT                   TSQPGAGLSTNSSVWTLAVGMVQVAIGITVGLFIAALVVYPYGKRRSGLFSF"
     atgtctgact ccagacaagg gagtgagagt tctgccgcaa cctatcacag tcaaccagag        60
     tcagaaaata cccaagattc tgttggtccc gaaagccccg gatcaccgcc ggctccgcca       120
     ggaagtccac ggtcgcctga acagcagagc caggatggag acaaccagga aattcccaat       180
     atagagacca ccccgaaaag cggggaaaat ggagaaggat cacagaagag acagcgggtt       240
     cgcttccggt ccgccatcag tgtcgactac ccacagcccg gtggtcccga aagcagcgaa       300
     gatgaacgct ctattcagga gaagcaaaag gctcagcgtg accaagcgca acgccagggc       360
     cagccacatc tcatgtccac gccctacgtt catggatccc tagacgtcac agaaacccct       420
     ctcaaggagc ggaccaccca agaagacctt cagcaagcgg aaaagactcc agtggataag       480
     aaaccggacg gtattggcgc agcagcagcc gtcggcgatg tcagtcgcac agctaaggac       540
     aaactgcgat ggctgtggga tacagtgcac ggcaagttgt ccaagtggag tgatcggctg       600
     ggacgccctg aacgaggtgg ggatgaccta ggacccggtg tctaccacaa tgaatggaca       660
     tcaggcggca acgcgcctct gggagatttg actgacaaca agcacaagac tcacgaagaa       720
     aagaagtcac atcaagcaac gtccacgtct gaagcgcacc gccttgtgcg tgagctgacg       780
     caggaccagt ctggtaatcg gcgcaagacg cgggggaagc catacccaca caccgacacg       840
     cagggcggac agggcggcca aggaaacaat gcaatcgagt cggggctgcg gtatcgagcc       900
     gggggtgggg gtgttctggc gcagctgatg aaactgaatg gtggcatgca acaaggaggg       960
     caagctggac aagctggaca aggtgggcaa cggtcaccct ctgacaccgg gacctcaggg      1020
     accacaactc cgaagaagga aaagttaaag tggtacaaga ataaacagca tacccggtcc      1080
     acgtcgacgc tggttggcgc ttcggggagt atgagtggcg cgagcacccc ggtgtctagc      1140
     gaggttctct ctgccgcgtc gaagcgcctt ggtggacagc agttccagca agggggaagg      1200
     atgcgactgg aggacgagat tcaggtgacg gtgcaaatcg cggagatcat tgcgcgccag      1260
     cggtacatta tgcagctgtg taaggcgctg atgacctttg gcgccccgac gcatcggctc      1320
     gaagagtaca tgcagatgac agccaaggtg ctcgaggtgg acagtcaata cctgtatttt      1380
     cccgggtgca tgatcatgtc atttgacgat ccgtcgacga ggacgaccga ggtgaagctg      1440
     gttcgagtgg cgcagggaat caatctgcag aaactcgcca acactcatcg aatctacaaa      1500
     aatgtggtgc atgatgtgat cggagtggaa gaggctattc aggaactgga ggatattcaa      1560
     aagaaaccgc cgcgattcaa caagtggatc gtcgtgttgg tatacggatt ggcgtctgcg      1620
     actgtaggac cgtttgcgtt caatgcccgg ccgattgaca tgcccatcat cttcttcaac      1680
     ggctgtctgc tcggcctcat gcaacaagtc ttcgcgcctc gctcggcgct ctactcgaat      1740
     gtcttcgaag tgacggccgc agtgctcacc tcattcctgg cccgcgcctt tggcagcatt      1800
     cccaaggccg tcatcgacgg caagcggcag tttctcttct gtttctctgc catcgcccaa      1860
     tcctccattg cgctgatttt gcccggcttc ctcgtgctat gcagcagcct cgagctacaa      1920
     tcccaccaga tcatcgctgg gtctatccgc atggtctacg cgatcattta ctccctcttc      1980
     ctcggatacg gcatcacagt tgggacaacc atctacggac tgatggaccc gtcagctgta      2040
     tccgacatcc agtgtcccaa agccggggcc ttcaaaaacc catacctgca gcggtttccc      2100
     ttcgtggcca tcatgaccgt ctggctgctc atcatcaacc agggcaaatg gaaacagtta      2160
     ccggtgatgt cgaccatcgc catgtccggg tacatcacca actacttcag cacgaagcgg      2220
     ctgggctcca actcgcaggt cgccaacacc gttggcgctt tcaccatcgg cattatgggc      2280
     aatctgtaca gtcgcctgtg gcacggacat gctgcaacag ccatcctccc cgctatcctc      2340
     gtgctggtcc cctcgggtct tgcagcgtcc gggtcgctga tcaccggcgt ggcgtcggct      2400
     gatcagatcc ggcacaacat tagtagtccc agcgggacct cgcagccggg ggcgggcctg      2460
     tcaaccaatt cgtcggtgtg gacgctagcg gtggggatgg ttcaggtagc gattggcatc      2520
     acggttggct tgtttatagc ggcgttggtg gtgtatccgt atggcaagcg gcggagcggc      2580
     ttgtttagtt tctag                                                       2595
//

If you have problems or comments...

PBIL Back to PBIL home page