(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE215

ASFUM1_4.PE215       Location/Qualifiers
FT   CDS_pept        960152..960748
FT                   /codon_start=1
FT                   /gene_family="HOG000171311" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16258997"
FT                   /orf_name="AFUA_4G03360"
FT                   /product="GPI anchored protein, putative "
FT                   /protein_id="EAL84485.2"
FT                   /db_xref="HOGENOM:HBG054377"
FT                   /db_xref="UniParc:UPI0000F51ABD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9X8"
FT                   /transl_table=1
FT                   /translation="MQLVHLTALLLATATSTYAQDNNAIDSLVSAANNIVSNGQNIASN
FT                   VVADATSIASAFETGGAAAVSSLTSEAGAAASNVQSWASSVASDAQSRASDVASKASSA
FT                   WNEQLTTLTGTNGTPTATETRSVSETTSSTTATLTDTTTSTSGSFTTTMTRTSTSAGAA
FT                   GTSTSTSEGAGAQATPFLGAGIVGVAGVLGVMAAL"
     atgcaactcg tccacctcac agctctcctc ctggcaacag ccacctccac ctacgcacag        60
     gacaacaatg caattgactc cctagtctcc gcagccaaca acatcgtctc caacggccaa       120
     aacatcgcct ccaacgtcgt cgccgacgca acctccatcg cctccgcgtt tgaaaccggc       180
     ggcgcggcgg ccgtctcctc gctcacctcc gaggccggcg ccgcagcctc caacgtccag       240
     tcctgggcgt cgtccgtggc ctcggacgcc cagtcccgcg cttccgatgt ggccagcaag       300
     gcgtcgtcgg cgtggaacga gcaattgacc accctgaccg gaacgaatgg tacgccgacc       360
     gccacggaga cccggtcggt gagcgagacc accagttcga ccacggctac cctgacggat       420
     accacgacct cgacaagcgg gtcgttcacc accaccatga cccgcacgag cactagtgcc       480
     ggtgcggcgg gcacgtcgac ctccacgtcg gagggggcgg gtgcgcaggc taccccgttc       540
     cttggagcgg ggattgtggg tgtggctggt gtgttgggtg ttatggctgc cctgtag          597
//

If you have problems or comments...

PBIL Back to PBIL home page