(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE22

ASFUM1_4.PE22        Location/Qualifiers
FT   CDS_pept        join(complement(88689..89040),complement(87620..88653))
FT                   /codon_start=1
FT                   /gene_family="HOG000216784" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16273684"
FT                   /orf_name="AFUA_4G00330"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84385.1"
FT                   /db_xref="HOGENOM:HBG054294"
FT                   /db_xref="HOGENOM:HBG324393"
FT                   /db_xref="UniParc:UPI000051F4D8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W956"
FT                   /transl_table=1
FT                   /translation="MAQKVPNPTPGSNSTLLRRKPEGTHSQGITSHQVGIAWSWFLVTV
FT                   PIAALTAVFLVLVFHYRLYHGDPPFPNLRLPSAEDEKNVVYVDLSSSMILFTTSWASSV
FT                   APMLSSFVVALASSQATVYTYVDPDQTSYTYLGVPETASLLTQGFTAKTYGARTQCQLI
FT                   SSKCTLQNAASSVKFNCSADFTGLINTPTLQAAFFEDESMSKNLRGKVVSNCSTGNPDY
FT                   FALASVVNLSGGKTPNSTEFVKSLHGVPTYVLGCHTTIYDIEYDRLNNTVTRFQPAASN
FT                   TSVSNIWQTSISQTQDWFPFFQQAAGTAIFSDTAEEFAEKVALALSKATIALGADALGA
FT                   QPALAAQDRETLLVARIPVAPLVAMVAVCLLYVVCGLVLTGIAAWSARYEVRDVQARLS
FT                   IAGLVADRFEEPGLRSDANCVEEMFAEHAGQESKRIAIESVDGVGVYRYTTWPKPEGSA
FT                   SGW"
     atggcgcaaa aagtcccaaa ccccacgcct ggaagcaact ccacgttgct acggcgtaaa        60
     ccagagggta cacactcaca aggaatcacc tctcatcaag ttgggatcgc atggagctgg       120
     ttcctcgtca ccgtccccat tgccgcactg actgctgtct tcctggtgct ggtgttccat       180
     taccggctct accatggcga tccccccttt cccaatctcc gcttaccctc ggcggaggat       240
     gagaagaatg tggtctatgt tgatctgagc tcgagcatga tcctattcac tacgtcctgg       300
     gccagttccg tggctcccat gttgtccagc tttgtggtcg ccctcgcatc gtcccaggcg       360
     acggtataca catacgtcga cccggaccag acgtcctaca catacctggg ggtccccgaa       420
     accgcatccc tgctcaccca gggcttcaca gccaagacat acggtgctcg cacgcagtgc       480
     cagctaatct cgtcgaaatg caccttgcaa aatgcagctt cgtcggtcaa attcaactgc       540
     tccgctgatt ttacaggtct catcaacacg cccactctac aggcggcgtt cttcgaggat       600
     gaaagcatga gcaaaaacct ccggggcaag gtggtatcca actgcagcac cggcaatccg       660
     gactacttcg ccctcgcgtc cgtggtgaac ctctccggag gaaagacgcc caattccacc       720
     gagtttgtga aaagtctcca tggcgtcccg acctatgtcc tgggctgcca cacgaccatc       780
     tacgatatcg agtacgaccg cctcaacaac accgtgaccc gtttccagcc cgcggcgagc       840
     aacacctccg tcagcaacat ctggcagacg agcatttcgc agacccaaga ttggttcccc       900
     ttcttccagc aggctgctgg caccgcaatc ttcagcgata cggccgagga gttcgcggaa       960
     aaggtcgccc tggctcttag caaagcgacc attgccctcg gggcggatgc actcggcgcc      1020
     cagccggcgc tggccgccca ggatcgagag acgttactcg tggcccgcat tcctgtggcc      1080
     ccgcttgtcg ccatggtggc ggtttgtctt ctgtatgtcg tgtgcggctt ggttctgacg      1140
     gggatcgcgg cgtggagtgc ccgatatgaa gtccgggatg tgcaggcccg gctttccatt      1200
     gcgggtctgg ttgcggaccg gttcgaggaa cctgggttgc ggagcgacgc caattgtgtc      1260
     gaggaaatgt tcgccgagca tgcggggcaa gagagcaaaa ggatagccat cgagtcagtg      1320
     gatggagtcg gggtttatag atatacaacc tggccgaagc cagaaggttc tgcctctggc      1380
     tggtga                                                                 1386
//

If you have problems or comments...

PBIL Back to PBIL home page