(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE222

ASFUM1_4.PE222       Location/Qualifiers
FT   CDS_pept        join(complement(974204..974273),complement(973787..974143),
FT                   complement(973613..973740))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16258999"
FT                   /orf_name="AFUA_4G03435"
FT                   /product="Formate/nitrite transporter family protein,
FT                   putative"
FT                   /function="transporter activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="EBA27182.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="UniParc:UPI0000F51A9B"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA66"
FT                   /transl_table=1
FT                   /translation="MLRPRSPWGNLAGSLFVVAIIFGYGNVFAADPYKSEVIAFATKKQ
FT                   LTPDFHQIFLRGIGCNWLVCLACFLGVQGRDLASKVVGIWFPTFAFVSLGFDHLVANMT
FT                   FIPLAIWLGAPKITVALYIWKGIIPTLLGNIIGGGLFVATYYWYMYLVSGEMATLTGMR
FT                   QSATTTPRSLDIEAMAAEKQN"
     atgctccggc cgaggtcgcc ctggggcaac ctggcggggt ctctcttcgt tgtggccatc        60
     atctttggct atggcaacgt ctttgctgcc gacccctaca aatccgaggt catcgccttt       120
     gccacgaaga aacaactcac cccggacttc catcagattt tcctccgcgg gatcggctgc       180
     aactggctgg tctgtctggc ttgcttcctc ggcgtccagg gccgcgatct cgcctccaag       240
     gtggtaggca tctggttccc gacctttgcc ttcgtgtcgc tgggctttga ccacctcgtc       300
     gccaatatga ccttcatccc cctggcgatc tggctggggg cgcccaagat cacggtagcg       360
     ctgtacatct ggaaggggat cattcccacg ctgctgggga atatcattgg aggtggattg       420
     tttgtcgcga catactactg gtacatgtac ctcgtgagcg gagagatggc cactctcacg       480
     gggatgcgcc agtcagccac gacgacgcct cgttcactgg atatcgaggc catggctgct       540
     gagaagcaga actaa                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page