(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE223

ASFUM1_4.PE223       Location/Qualifiers
FT   CDS_pept        join(975430..976106,976167..976620)
FT                   /codon_start=1
FT                   /gene_family="HOG000159139" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259000"
FT                   /orf_name="AFUA_4G03440"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84493.1"
FT                   /db_xref="HOGENOM:HBG054383"
FT                   /db_xref="HOGENOM:HBG670383"
FT                   /db_xref="UniParc:UPI0000520209"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9X0"
FT                   /transl_table=1
FT                   /translation="MKSIFALTGLLSLVLSASAADPRLCPKGNDPLPASAFTLQQSKDN
FT                   SHLASLSHIFSVAGKNVSIARVLDSANRDLAKGKPPVGTTPVEAWKWNPGDMATKKWVP
FT                   QGITGSADASASGKWDGREMWLVSWHRDDDKSVRVSFVDRKTHKYRHVLLVEPTADDNF
FT                   AAVPVHAGGIAWYGEWLYVVDTSHGIRVFDLGQIWQVEDGDDVGKKGGKYSAAGYLYVL
FT                   PQIRSYKWTPGSSSPFRFSWISVDRSDNTLLVGEFIRDSSKDPIRLVKYPLDTNSGKLK
FT                   TNDKSIVTATFAHCADFLRMQGGFSYDNTFYISRSNGRSPKAGDMFKWKPGKPAELRNR
FT                   WFMAGNEDLSYNKVRKEYYTVSEYDGERFILAYNKM"
     atgaagtcca tcttcgccct caccggtctc ctctctctcg tcctctctgc cagtgcagca        60
     gacccccgtc tctgccccaa aggcaatgac cccctgccgg cttcggcctt taccctccaa       120
     caaagcaagg acaacagcca tctagcctcc ctctcgcaca tcttctccgt ggccggcaaa       180
     aatgtcagca tcgctcgcgt gcttgactcg gccaaccgtg acctcgccaa ggggaagccg       240
     ccggtcggga cgacccccgt cgaagcctgg aaatggaacc ccggcgacat ggccacgaag       300
     aaatgggtgc cgcaggggat caccggttcc gcggatgcct ccgcctcggg caaatgggac       360
     ggccgcgaga tgtggctggt cagctggcac cgcgatgacg ataaaagcgt gcgcgtgagc       420
     tttgtcgacc gcaagacgca caagtaccgc catgtgctcc tggtggagcc cactgcggac       480
     gacaactttg ctgccgtgcc cgtgcatgcg ggtggcattg cgtggtacgg agagtggttg       540
     tacgtggtgg atacatcgca cggcatccga gtgttcgatc tcgggcagat ctggcaggtg       600
     gaggatggcg acgacgttgg aaagaagggg ggaaagtact ctgctgcggg gtacctctat       660
     gtgcttcctc agatccgatc ctacaaatgg acccccggct cctcgtcccc gttccgtttc       720
     tcttggatct cggtcgatcg cagcgacaac acgctgttgg tcggcgagtt catccgcgac       780
     tcctccaaag accccatccg tctggtgaag tacccgctgg acaccaacag tggcaagctc       840
     aagaccaacg acaagagcat cgtcaccgcc acatttgcac actgtgccga cttcttgcgc       900
     atgcagggcg gcttctccta cgacaacacc ttctacatct cacgcagcaa tggacggtca       960
     cccaaagccg gagatatgtt caagtggaag cctggcaaac cagcggaatt gcggaatcga      1020
     tggttcatgg cgggaaatga ggatctgagc tacaacaagg tgcgcaagga gtattatact      1080
     gtgagcgagt atgatgggga gcgattcatt ctggcctata acaagatgta g               1131
//

If you have problems or comments...

PBIL Back to PBIL home page