(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE224

ASFUM1_4.PE224       Location/Qualifiers
FT   CDS_pept        join(976914..977174,977243..977920)
FT                   /codon_start=1
FT                   /gene_family="HOG000171278" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259001"
FT                   /orf_name="AFUA_4G03450"
FT                   /product="NmrA-like family protein "
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="EAL84494.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG054384"
FT                   /db_xref="HOGENOM:HBG327460"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051F3E6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9W9"
FT                   /transl_table=1
FT                   /translation="MSQKIGIFPASGGLGTSIINHLVKLVPASQLILIARNPEKLASFS
FT                   RDGATIRRADYDDRASLERVFDGVGVLMLISYASFEIQHRVEAHKAAIDAARRSGVKHI
FT                   FYSSLAFAGDLGESSLAHVMGAHLATEKYLAELPGHFTYTAIREGLYSESFPIYTAWFD
FT                   PHQPVEEITIPHPGTGPGVAWAKRDELGEATAKMIYAYAKNTAGFPYLNRVVLLSGPRE
FT                   VSLAETAEVLGRAVGKPVRIREISVDEYVALPQIGDKHTYHGLNLSREWATAWAAIRAG
FT                   ETAVVSPLLGEILGREPEDFETTIRALVGAR"
     atgagccaga aaatcggcat cttcccagcc tccggcggcc taggaacaag catcatcaac        60
     catctcgtca agctcgtccc ggcctcacaa ctcatcctca tcgcccgcaa ccccgaaaag       120
     ctagcctcgt tctcccgcga cggcgcaaca attcgccgag cagactacga tgaccgcgca       180
     tccctcgagc gcgtcttcga cggcgtcggc gtcctgatgc taatctccta cgcctccttc       240
     gagatccagc accgagtaga ggcccacaaa gccgccatcg acgccgcccg ccgcagcggc       300
     gtcaaacaca tcttctactc ctccctcgcc ttcgccggcg acctgggcga gtccagcctc       360
     gcgcacgtca tgggcgccca cctcgcaacg gaaaagtacc tcgccgaact ccccggccac       420
     ttcacctaca ccgccatccg cgagggcctc tactccgagt ccttcccgat ctacaccgcg       480
     tggttcgacc cgcaccagcc cgtcgaggag atcaccatcc cgcacccggg gacggggccc       540
     ggggtggcgt gggcgaaacg cgacgagctg ggcgaggcca ccgccaagat gatatatgcg       600
     tatgcgaaga acacggcggg cttcccgtat ctgaaccggg tggtgctgct ttcgggaccg       660
     agggaggtga gtctggcgga gacggcggag gtgctggggc gggcggtggg gaagcctgtg       720
     cggatccggg agatctcggt ggacgagtat gtggcgctgc cgcagattgg ggacaagcat       780
     acgtaccacg ggttgaatct gtcgagggag tgggcgacag cgtgggcggc gatccgggcg       840
     ggggagacgg ccgtcgtgtc gcctcttctg ggggagattc tggggaggga gccggaggat       900
     tttgagacta cgatccgggc cttggttggg gcgaggtag                              939
//

If you have problems or comments...

PBIL Back to PBIL home page