(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE225

ASFUM1_4.PE225       Location/Qualifiers
FT   CDS_pept        join(981962..982249,982311..982922)
FT                   /codon_start=1
FT                   /gene_family="HOG000171267" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259002"
FT                   /orf_name="AFUA_4G03460"
FT                   /product="HLH DNA binding domain protein, putative "
FT                   /function="transcription regulator activity"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL84495.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG051277"
FT                   /db_xref="HOGENOM:HBG327458"
FT                   /db_xref="InterPro:IPR001092"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="UniParc:UPI000051EA53"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9W8"
FT                   /transl_table=1
FT                   /translation="MAYNNRPDASTAFTFDNDDRFVNQQPKGPDPLSANWSYDSAIDLF
FT                   SLNTMLPETFPLDIPNDMLLDPKDFPTDLFAPPADISGFAISHSGEDSLSSDQESEDQP
FT                   WSPAYRVSSLDSTTPDAPTVSPRSTEKPATRRRTTTQKREQATRWSSSPEMTPQEYPVT
FT                   SQATTSPAPAPVSPPAASTSRKNSRSLSTDSQTATGRNAAKRAAHNIIEKRYRTNMNAK
FT                   FVALEKAMSGSGVQKPTKGGSGPASLKKSEILTNAIAYMQELQDQNAALQKELALLKQN
FT                   LLPGGLWRHNKENDKFRT"
     atggcataca acaacagacc tgatgcctcc acggcattca cctttgacaa tgatgaccgc        60
     tttgtcaacc aacagcccaa aggccccgat ccattgtcgg ccaattggag ttatgacagc       120
     gccatcgatt tgttttcgct gaacaccatg cttcccgaga ccttccctct cgatatcccc       180
     aatgatatgc tgctcgatcc caaggatttc cctacggatc tgtttgctcc gccggctgat       240
     atcagcgggt ttgcaatctc ccactctggc gaggattctc tctcatcgga tcaggaaagt       300
     gaagatcaac cgtggtctcc cgcctaccgt gtctcatcac tcgactcgac cacgccagac       360
     gcccccaccg tttcgccacg ctcaactgaa aagccagcca cccgccgcag aaccaccacg       420
     cagaaacgcg aacaagcgac tcgttggtcg tccagtcctg aaatgacccc tcaagaatac       480
     cccgtcacct cacaagccac cacttctccc gcccctgcac ccgtctctcc ccccgcggcc       540
     tccacctccc gcaagaactc ccgcagtctc tccaccgact cgcaaacagc aaccggccgc       600
     aatgcagcca agcgagctgc ccacaacatc atcgagaagc ggtaccgcac caacatgaac       660
     gccaaattcg tcgcgctgga aaaagccatg tccggcagcg gggttcagaa acctaccaag       720
     ggcgggtctg ggcccgcctc gctgaagaag tcggagatcc tgaccaatgc cattgcctac       780
     atgcaagagc tgcaggacca gaacgccgcg ctgcagaagg agctggcgct tctgaaacag       840
     aatctgctcc cgggcggact gtggcggcat aacaaggaga acgacaagtt tcgcacctag       900
//

If you have problems or comments...

PBIL Back to PBIL home page