(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE23

ASFUM1_4.PE23        Location/Qualifiers
FT   CDS_pept        complement(92305..93351)
FT                   /codon_start=1
FT                   /gene_family="HOG000175373" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20753328"
FT                   /orf_name="AFUA_4G00340"
FT                   /product="Putative uncharacterized protein "
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="endoplasmic reticulum"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL84384.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG054292"
FT                   /db_xref="HOGENOM:HBG324390"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniParc:UPI000051F257"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W957"
FT                   /transl_table=1
FT                   /translation="METKGNPKDSMKSTWRTASRDTWSLGHWLIHILNAYPLELDKEVP
FT                   VHSKDEPIPFMPQWSLNLWVIFYSSLPLLFHQAYAWYTERNLGPLATFNLYMFAFNAIV
FT                   IYQVHILRRLGHIYGFLDGDKHERDGIPDVGVGKVVASVYKTTGSRLALSVYFSYQTSQ
FT                   LPAQMNWYWLPVEVGLYGIVLDFWFYWYHRLMHDVSFLWKYHRTHHLTKHPNPLLTAYA
FT                   DHEQEFGDMVGVPMMTYFTLRLLGLPMGFYEWWICHEYVVFAEVFGHSGLRLHLTVPSP
FT                   LSWLMQWLDAEIVIEDHDLHHRKGWRKSHNYGKQTRLWDRIFGTCHERIESAPENVDYV
FT                   NTARMPLF"
     atggagacca aaggcaaccc taaagattcc atgaagtcca cctggcgtac tgccagcagg        60
     gatacctgga gcctcggaca ctggctcatt catatactca acgcctaccc tttagaactc       120
     gacaaagagg taccggtgca ctccaaggat gaaccaattc cattcatgcc acagtggtcg       180
     ctcaacctat gggttatttt ctactcgtct ctaccactgt tgtttcacca ggcctacgca       240
     tggtacaccg aacgcaacct gggtccttta gccaccttta atctgtatat gtttgccttc       300
     aatgcgatcg tcatctacca ggtacacata ctccggcgac tcggtcacat atatggcttt       360
     ctagatggcg acaaacacga acgagacggc attcctgacg tcggggtcgg caaggtcgtg       420
     gcctcggtgt acaaaacgac cggttctcgc ttggcgctct cggtgtactt ctcctatcag       480
     acgagtcaac ttcctgcaca gatgaactgg tactggttac cggttgaggt cggactgtac       540
     ggcatcgtgc tcgacttctg gttctactgg taccatcgcc tcatgcacga cgtcagcttc       600
     ctctggaagt atcaccgcac tcaccacctg accaagcacc ccaatccttt gctcacggca       660
     tacgcggacc acgagcagga attcggcgat atggtcgggg tgccgatgat gacctacttc       720
     actctgcggc tgctggggct gccgatgggc ttctacgagt ggtggatctg ccatgaatat       780
     gttgttttcg ccgaggtgtt tgggcacagc ggtctgcgct tgcatctgac cgtcccgtcg       840
     cccctcagct ggctcatgca gtggctcgat gccgagattg tcattgagga tcatgacctg       900
     catcatcgga aggggtggcg gaagagccac aactacggca agcagactcg tctttgggat       960
     cggatctttg gaacctgtca tgaacggatt gagtcggcac ctgagaatgt ggattatgtg      1020
     aataccgcca ggatgccatt gttttga                                          1047
//

If you have problems or comments...

PBIL Back to PBIL home page