(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE234

ASFUM1_4.PE234       Location/Qualifiers
FT   CDS_pept        999848..1000690
FT                   /codon_start=1
FT                   /gene_family="HOG000217284" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259011"
FT                   /orf_name="AFUA_4G03550"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84504.1"
FT                   /db_xref="HOGENOM:HBG054391"
FT                   /db_xref="UniParc:UPI000051FDA3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9V9"
FT                   /transl_table=1
FT                   /translation="MVVNADSISRHALGLSPTTSEYPYQGMKHFRDIVYKEAATTRNDY
FT                   VIFTNIDEHTFLRDFDESLRKSYSDFFPQARILVARMPATEVHEAAHTELHNTLMIMLG
FT                   AMNVHSQLLSLGVADVVTPTRTKEPDQSYKPMNFPAGYSSHWPSMVIETAFSESQSTPA
FT                   NDARWWLNASGGELKIVITIAVQKKREAITIDKWEATSRPTRGDPGKTVPEVVQKVTIT
FT                   REGGDAPVHVTGAPLIIGFEKLFLRPAEEEKGEGDVLFSHDDLAEIADKVWSVLNTGN"
     atggtcgtga atgcagacag catcagccgc catgcgcttg ggcttagtcc cacgacaagt        60
     gaatatccct accagggcat gaaacacttc cgggacatcg tctacaaaga agcagcaaca       120
     acgagaaacg actacgtgat cttcaccaac atcgacgagc ataccttcct acgggatttc       180
     gacgagtcct tacgaaaatc atacagcgat ttcttcccgc aggctcgcat ccttgttgct       240
     agaatgcctg ccaccgaagt tcacgaagcg gcgcacaccg agctccacaa tacacttatg       300
     atcatgctcg gggccatgaa tgtccactct cagctgctgt cgctcggagt ggccgatgtg       360
     gtgactccca cacgaactaa ggagcccgac caatcgtaca agcctatgaa tttcccagct       420
     ggttactcca gtcactggcc gtctatggtg atcgagactg cgttctccga gagtcagagc       480
     acaccggcca atgatgcgcg ctggtggttg aacgcttccg ggggagaatt gaagatcgtc       540
     atcaccattg cagtccagaa gaaacgggag gctatcacta ttgacaaatg ggaggcgacc       600
     agccggccca cacgaggcga cccggggaag acggtgcctg aggttgttca gaaggtgact       660
     atcacaaggg agggaggtga tgccccagtg catgtcactg gggctcccct gatcataggg       720
     tttgagaagc tgttcctccg gcctgccgag gaggagaaag gggaggggga cgtactgttt       780
     agtcacgatg atttggccga aattgccgac aaggtctgga gtgtcctcaa tacgggtaac       840
     taa                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page