(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE236

ASFUM1_4.PE236       Location/Qualifiers
FT   CDS_pept        join(1004780..1004835,1004880..1005603)
FT                   /codon_start=1
FT                   /gene_family="HOG000171221" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259013"
FT                   /orf_name="AFUA_4G03580"
FT                   /product="Phosphoglycerate mutase family protein "
FT                   /EC_number="3.2.1.22"
FT                   /function="alpha-galactosidase activity"
FT                   /protein_id="EBA27183.1"
FT                   /db_xref="GO:0004557"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="UniParc:UPI0000F51A90"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA67"
FT                   /transl_table=1
FT                   /translation="MKLYLIRHAETVDNVAHRLAGVKDSPLTNHGALQIIRLGRYFASQ
FT                   NIKFSHIFSSDLSRAIRTAEGLSSHQPELSPVLLPSLRERDFGSFEGQKWHSTWESSIV
FT                   PKQPESEASMRQRANTFLTDYLVPLLLAGDEAGDEAGDEAVVAVVSHGLLLRSLWRALL
FT                   AYFHPSDVCIVGDADVNAFNPFWANTGYLELLVRPRLSPLVGVPEMPVLGGYSLQVLGV
FT                   NSRAHLADLRRTKGGVGSATFDQRQKRIDHFFGQKNR"
     atgaaactct acctcatccg ccacgcggaa acggtcgata atgtcgctca tcgattagcc        60
     ggagtcaaag actcgcccct gacaaatcac ggcgccctcc agatcatccg tctggggaga       120
     tatttcgcct cccaaaacat caaattcagc catatcttct cgtcagatct ctccagagca       180
     attcgcacgg ccgaagggct cagctcgcat cagccggaat taagcccggt attgctgcca       240
     tccctccgtg aacgcgactt tggctccttt gaggggcaaa agtggcattc cacctgggaa       300
     tcgagcatcg ttcccaagca gcctgaatct gaggcttcta tgcgtcagcg tgcaaataca       360
     tttcttaccg actacttagt ccccttgctt ctcgctggcg acgaggcggg ggatgaggcg       420
     ggggatgagg ctgtagttgc cgttgtctct cacgggctac tcctacgaag tctgtggcgc       480
     gctctactcg cgtatttcca tccgagcgat gtttgcattg tgggagacgc ggatgtcaac       540
     gcgtttaatc cgttctgggc gaatacaggg tacttggagc tcttggttcg tccgagattg       600
     agccctttag taggagttcc ggaaatgccg gttctgggtg ggtattcgct gcaggtactt       660
     ggagtaaaca gtcgagcaca tctggcagat cttcggcgta cgaagggggg ggtcgggagt       720
     gctacttttg atcagcggca gaaacggatt gatcatttct ttggtcagaa gaatcgatag       780
//

If you have problems or comments...

PBIL Back to PBIL home page