(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE239

ASFUM1_4.PE239       Location/Qualifiers
FT   CDS_pept        complement(1011241..1011687)
FT                   /codon_start=1
FT                   /gene_family="HOG000217751" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259015"
FT                   /orf_name="AFUA_4G03595"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27185.1"
FT                   /db_xref="HOGENOM:HBG324425"
FT                   /db_xref="UniParc:UPI0000F51A91"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA71"
FT                   /transl_table=1
FT                   /translation="MTSMSTSTTTGTAAASTCTGNRWVLPVQDVACALPATGNYSSIMD
FT                   KCCSPAAVTKYNDGCGLYCLAQGQSMGDLLDCIKENGGNKDVFCGGQLNATATASLSET
FT                   ASSTATRTGTGASASETRDNGAPTKRVSVLGVGLVAMIVCGMFV"
     atgacctcaa tgtcgacctc caccaccaca ggaacagcag ccgcatcaac ctgcacaggc        60
     aaccgctggg ttctccccgt acaagacgtg gcatgcgccc tccccgcaac agggaactac       120
     tcctccataa tggacaaatg ctgctccccg gcagccgtga ccaaatacaa cgacgggtgc       180
     ggcctgtact gtctcgcgca ggggcaaagc atgggcgact tgctggactg catcaaggag       240
     aatggaggca acaaggatgt gttttgtggg ggccagttga atgctaccgc gacggcgagt       300
     ttgagtgaga cggcgtccag cacggcgacg aggacgggga ccggggcgag cgcgagtgag       360
     acgagggata atggtgctcc cacgaaacgg gtgtcggttt tgggggttgg attggtggca       420
     atgattgtgt gtgggatgtt tgtttaa                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page