(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE24

ASFUM1_4.PE24        Location/Qualifiers
FT   CDS_pept        join(complement(94930..95754),complement(94739..94897))
FT                   /codon_start=1
FT                   /gene_family="HOG000200344" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16273685"
FT                   /orf_name="AFUA_4G00350"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84383.1"
FT                   /db_xref="HOGENOM:HBG054281"
FT                   /db_xref="UniParc:UPI000051FC23"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W958"
FT                   /transl_table=1
FT                   /translation="MLSEQTCSHSSIRSDSSPHAAKVGYEQRSLKQRTSAARLPGSPAP
FT                   SGSIDPTIFPAPLVLPGDDLALDPEYPPQSVLDWLDEEDRNEVTSDRKTVYVVAPPEYD
FT                   EDAYFAQAWTSPRVAKSQHHLIAPNPEDIVGYLAAFYHGMPVKLLRVSDFRFLPWDGQK
FT                   PTTSPRFIGLAVSDECIGIRTRACPDKLYPRQLNLDDLLDVAISILPQDAYALCLLVNH
FT                   DLYEDADDTFVCGRAYGGSRVAVVSSARYCPTLDEVQSVDREHSWPASHCDDYYQKAED
FT                   RQRIVILGYCTINRRGSRIVFPPKCRCITTVTIITLAFSTMPHCKP"
     atgctttcgg aacaaacatg ctcccattct tctatacgtt ccgactcctc ccctcatgct        60
     gccaaagtag gttatgaaca acgcagcctg aagcaaagga cttctgccgc gagactacca       120
     ggatccccag ccccatctgg cagtattgat ccaaccatat ttccagctcc gttagttttg       180
     cctggtgatg acctggcact ggaccccgag tacccacccc aatctgtttt agactggttg       240
     gacgaagagg atcgcaacga agtcacttca gacagaaaga cggtctatgt tgttgcgcca       300
     cctgaatatg acgaggatgc ctatttcgcg caggcatgga cctctcctag agtggccaag       360
     agtcagcatc acctgatagc acctaatcca gaagatatcg ttggttacct ggcggcattc       420
     taccatggga tgcccgttaa gctccttcga gtatcggact ttcgatttct tccttgggat       480
     ggtcaaaaac ccacaacctc accccggttc attggcttag ccgtttcaga cgaatgcatt       540
     ggcattcgga ctcgtgcatg ccccgacaaa ctttaccctc gtcaattgaa cctggatgat       600
     ctcctagatg ttgcaataag catacttccc caggatgcgt atgccttgtg tcttctggtg       660
     aaccatgatc tatatgagga tgctgatgat acgttcgtct gcggacgtgc atatggtgga       720
     agtcgcgtgg cagtcgtctc cagcgccagg tattgtccaa ccctggacga agttcagtca       780
     gtagaccgag aacattcgtg gccagcatca cattgtgacg actactacca aaaagcggag       840
     gaccgccagc gaatcgtcat ccttggctac tgcaccatta accgccgcgg tagccgcatt       900
     gtcttccctc ccaaatgtcg atgtatcacc acggttacta tcatcactct ggctttctcg       960
     actatgccgc actgcaagcc atga                                              984
//

If you have problems or comments...

PBIL Back to PBIL home page