(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE242

ASFUM1_4.PE242       Location/Qualifiers
FT   CDS_pept        join(1017220..1017296,1017353..1017490,1017547..1017643)
FT                   /codon_start=1
FT                   /gene_family="HOG000166313" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19901725"
FT                   /orf_name="AFUA_4G03615"
FT                   /product="Conidiation protein Con-6, putative "
FT                   /protein_id="EBA27187.1"
FT                   /db_xref="HOGENOM:HBG676962"
FT                   /db_xref="InterPro:IPR018824"
FT                   /db_xref="UniParc:UPI0000F51AB6"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA72"
FT                   /transl_table=1
FT                   /translation="MPRARSRSREPSEGRDPENVMRGYKATLHNPNVSQQAKQHAQQEL
FT                   DRYESGYATSKSEEDRHASNVKRGLKAATHNPNVTDMGKKQARDKLQAMGEQPEEPGD"
     atgcctcgag cccgaagccg aagccgcgag cccagcgaag gccgcgaccc cgagaatgtc        60
     atgcggggat acaaagccac cctccacaac ccgaacgtct cccagcaggc caagcaacac       120
     gcgcagcagg agctcgatag gtacgagagt ggttacgcca ccagcaagag cgaggaggat       180
     cggcatgcgt cgaatgtgaa gagggggttg aaggcggcaa cgcataatcc caacgtgaca       240
     gatatgggga agaagcaggc gagggataaa ttgcaggcga tgggggagca gcctgaggag       300
     ccgggtgatt ag                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page