(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE243

ASFUM1_4.PE243       Location/Qualifiers
FT   CDS_pept        join(complement(1019125..1019281),
FT                   complement(1017696..1019053))
FT                   /codon_start=1
FT                   /gene_family="HOG000171098" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259017"
FT                   /orf_name="AFUA_4G03620"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84511.1"
FT                   /db_xref="HOGENOM:HBG054398"
FT                   /db_xref="HOGENOM:HBG327402"
FT                   /db_xref="InterPro:IPR022703"
FT                   /db_xref="UniParc:UPI000051F18B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9V2"
FT                   /transl_table=1
FT                   /translation="MIEDNKSGGNSTKSAETLRETEPSSTGAVSVGFWDPALQETRKRI
FT                   IYLWSRTVLGLCVFILSILSLYWAVQFRSEDRLHTLTVWVVDFDNQVDPYRNESITPIV
FT                   GPAVTDVANRLIKSEREHVGYEIRSPADFNFDPWAVRQGVYDEHAYAAIIVNPNATTLL
FT                   YEAVTNGHSSYDPTGAAQFIIISARDQATYSNYIEPALSWFQLEVFAEFGPRWIQTLTR
FT                   ESMDISRVPQAVNPAIGFYKVDLRPFGPAAATPSVTIGLIYLIIIAFFNTPFLMPVHMQ
FT                   FIKGDHPPLKNAQWLIWRLCSSILAYFFLSLFYSFVSLAFQIPFAHSPAPDTLPADDPN
FT                   AYGHGSFVVFWMLNWVGMTALGLPCENMGMILGFPYSALFLIFWVITNVATGFYALDLA
FT                   PGFFAWGYAFPLHRSKSSILRTALRLSNSCSCRGAPDYSLRHAFLDWTRLWHSVCVDRI
FT                   VHHIIPICRICHALEDEARIVIFARDRSIHSNQFIILDTSQHNLFS"
     atgatcgaag acaacaaatc tggaggtaac agtaccaagt cggccgagac tcttcgggag        60
     actgagccct cctccaccgg tgctgtctcg gtcggctttt gggatcccgc gttacaagag       120
     acccgcaagc gaatcatata cctctggagt cggacagtgc ttgggttgtg tgttttcatt       180
     ctcagcattc tttcgctcta ctgggccgtc caattccggt cggaagacag gctgcacact       240
     ttgaccgtct gggtggtcga tttcgataac caggtggacc catacaggaa tgagagcatc       300
     acgcccattg ttggaccagc cgtgacagat gtcgcgaatc ggcttatcaa gtcggagaga       360
     gaacacgtgg gatatgaaat cagatcgcca gcagacttca actttgatcc ttgggcggtc       420
     cggcaagggg tctatgatga acatgcgtat gccgcaatca ttgtcaaccc taatgctact       480
     actctcctat acgaagccgt gaccaacggc cactcgtcgt atgatcccac tggcgctgct       540
     caatttataa tcatcagcgc gcgtgaccag gccacatatt ccaactacat cgaaccggcc       600
     ttgtcctggt tccagttgga agttttcgcc gaatttggcc ccaggtggat tcagactctc       660
     acaagggagt ccatggacat ctcccgggtg ccgcaagctg tcaacccggc gattggtttc       720
     tacaaagttg acctgcgacc atttggcccg gctgctgcaa cgccgtcggt gaccatcggt       780
     ttgatttatc tgatcattat cgcctttttc aacactccct tccttatgcc tgttcatatg       840
     cagttcatca agggggacca cccgcctctg aaaaacgcgc agtggctcat ctggcggctg       900
     tgttcaagca tcctggccta ctttttcctg tcgctgtttt attcgtttgt gtcgctggcc       960
     ttccagatcc cgttcgccca tagtccagcg ccggatacgt tgcctgcgga cgatcccaat      1020
     gcctatggac atggatcttt cgtggtattc tggatgctga attgggttgg catgactgcg      1080
     cttggattac cctgcgagaa catggggatg atcctcggat ttccctacag cgcccttttt      1140
     cttatttttt gggtcatcac caacgtcgcc actggcttct atgcgttgga tctggcccct      1200
     ggattcttcg cttggggcta tgccttccct ttgcatcgca gtaagtcttc catccttcga      1260
     actgccttgc ggctgtctaa ctcgtgtagt tgtcgaggcg ctccggacta ttctcttcgg      1320
     cacgcattcc tggattggac tcgactttgg cattctgttt gcgtggatcg gattgtccat      1380
     catattatac ccatttgccg catttgtcat gcgctggaag atgaagcgag gattgtaatt      1440
     ttcgctcgcg atagaagcat acactctaat caatttatca tactagatac ctctcaacat      1500
     aatctatttt cataa                                                       1515
//

If you have problems or comments...

PBIL Back to PBIL home page