(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE249

ASFUM1_4.PE249       Location/Qualifiers
FT   CDS_pept        join(1029779..1030612,1030663..1031490)
FT                   /codon_start=1
FT                   /gene_family="HOG000217282" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259020"
FT                   /orf_name="AFUA_4G03670"
FT                   /product="C6 transcription factor, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL84516.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG054399"
FT                   /db_xref="HOGENOM:HBG327393"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000051F8BD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9U7"
FT                   /transl_table=1
FT                   /translation="MPLNKRPRTEPIVRVRTGCWTCRRRKKKCDENRPVCGGCTRNKLS
FT                   CHWPAHVSSRPLENDRGAIPVQTDQHSRGSGQMDEENIIIPHGSPQSVRSSISHGASSH
FT                   SPFSPAVSPTSPAQSVCLPTVSPTGAIGLEDLDAASLVPMGYSHPRSNSQASIRDVMPR
FT                   SLSMLPGYSPESYQLLSHYLATTADCMANGSTPVNPFLVQIVPLAFTSDLLLQLVLTQS
FT                   AAHRAFRCRNDSDEVAQSHYTKALQLFRKGVTDFIDGKESNPLMLTVGALLMCFTETAR
FT                   GDMNGTIFDHLSAANTLLIRLLAESDTAVPKDLKNFVIEYYTYTATVSMISIDARVSRQ
FT                   LFLNFDLEQRARQLLESEYIGNLCGCWLELLLMIPCIFDLGRQWMMEDGQPGLPTADDI
FT                   AMFGSLQAQILRWTPYPSVTPEVFLAGRIFQQAMLLYLYTSLGAFSRAEQGIYQGLIDA
FT                   AITDAMSYLHQLSATARINSGLCWPIAVVGSCLSDLDQQNSLRQRLHIMVNTFGLGNMQ
FT                   RTLLLLEHMWQVPLEQAGPWNICRAMQQHQIWISFA"
     atgccgctca ataaacgccc acggacagag ccaatagttc gcgttcgaac cggctgctgg        60
     acctgcagac gccggaagaa gaaatgcgat gaaaatcggc ccgtctgtgg tggttgcaca       120
     cgaaacaaac tcagctgtca ctggcctgct cacgtatcat caagacctct tgaaaatgac       180
     aggggtgcga taccggtgca gacggatcag cactcacgcg gaagtggtca gatggacgag       240
     gagaacatta tcatcccgca tggcagccca cagtccgttc gaagctcaat ctcacatggt       300
     gcctcttcgc attcgccctt ctcgcctgca gtctctccaa cctcacctgc gcagtcagtg       360
     tgcctgccaa ctgtatcccc gacaggggcg attggactgg aagatcttga cgctgcgtct       420
     ctagtgccta tgggctattc tcatcctaga agcaacagcc aggcctcaat cagagatgta       480
     atgccgcgta gtctgtcaat gctccctggg tacagtccgg agtcctacca gctattgagt       540
     cattacttgg ctaccactgc cgactgcatg gctaatggat cgactccggt gaatccattt       600
     ctggtccaaa tcgttccact ggcattcaca agtgaccttc tgctacagct ggttctgacg       660
     cagagtgcgg ctcaccgagc atttcgttgt cgcaatgact cggatgaggt ggcccagagt       720
     cactatacca aagcgctaca gctgttccgc aagggtgtta cggattttat tgatgggaag       780
     gagtcgaatc cgctgatgct tacagttgga gctttgttga tgtgtttcac cgagaccgcc       840
     agaggagaca tgaatgggac catctttgac cacctgtcgg ccgcgaatac attgcttatc       900
     cggctgcttg ccgagagcga cactgcggtc ccgaaagacc tcaagaactt tgtcatcgaa       960
     tactatacgt acactgcgac agtgagcatg atatcaatcg acgcgcgggt gagccgtcag      1020
     ctcttcctga attttgacct agagcagcga gcgcgtcagc tgttagaatc ggaatatatc      1080
     ggtaatctct gcggctgctg gcttgagctg ctactgatga tcccgtgtat ctttgacttg      1140
     ggacggcaat ggatgatgga agatggccag ccgggtcttc cgactgcgga tgacattgcc      1200
     atgtttggct cattgcaagc tcagatctta cgctggacgc cttatccttc ggtaacaccc      1260
     gaggtattcc tggcaggacg aatcttccag caggcgatgt tgctctatct ctatacctca      1320
     ctgggtgcat tctcaagggc cgagcaggga atataccaag gccttatcga tgctgcaatc      1380
     acagacgcga tgtcttacct gcatcaactt tcagctacgg ctcgtatcaa ctcaggactc      1440
     tgctggccta ttgctgttgt ggggtcatgt ctgtctgacc tggaccaaca gaattcttta      1500
     cgacagcgcc tgcacatcat ggtaaacacg tttggccttg gcaatatgca acggacgctg      1560
     ctattgctgg agcatatgtg gcaggtgcct ctggagcaag ccggaccatg gaatatctgt      1620
     cgggcgatgc agcagcatca aatctggatc tcgtttgcgt aa                         1662
//

If you have problems or comments...

PBIL Back to PBIL home page