(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE25

ASFUM1_4.PE25        Location/Qualifiers
FT   CDS_pept        join(96220..96643,96694..97313)
FT                   /codon_start=1
FT                   /gene_family="HOG000216783" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18210058"
FT                   /orf_name="AFUA_4G00360"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84382.1"
FT                   /db_xref="HOGENOM:HBG054270"
FT                   /db_xref="UniParc:UPI000051FC29"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W959"
FT                   /transl_table=1
FT                   /translation="MVQQREEPPQQLSPRLQARLDEQFEIRDRFIRQEFARVHERIDDL
FT                   IKDNEARDKGIKREFRNVYERMDQMSQKMDQMSQKIDKLETSFTVFETTFANFKVAHLN
FT                   QRIQAIPVYDSFHQPVPVPKCFPKTALRLYRLQDRKNWNHLKTLLKHYNLERAAIQLVD
FT                   RGELYDSSDSDSDSDTSSRFHSIDRELDRAIESNPFAAMCSLGRHLGVDTDALHDRIMQ
FT                   LEFQQKKGTVAKRPAEDAGSVRKMIRELVTGALQPGSFTRAEPLLDDDSEGKYTKLEWE
FT                   VDSEKFKRETAHLRLRDTEVSPRPASAKDSPGNRQQRDLEVRSRQSKGSRSPTEKMTTS
FT                   SNQSQGH"
     atggtccaac aaagggaaga accgcctcag caactgtctc cgagactaca ggcgcgactc        60
     gacgagcagt tcgagatccg cgaccgattc attaggcaag aattcgccag ggtccacgaa       120
     aggatcgatg atctaatcaa ggacaatgag gctcgggata agggcatcaa gagggagttc       180
     cgcaatgttt atgagagaat ggaccaaatg tcgcagaaga tggaccaaat gtcacagaag       240
     atagacaagt tggaaacatc atttacggtt ttcgaaacaa catttgcgaa tttcaaggtg       300
     gcccacctta accaaagaat tcaagctatc cctgtgtacg actcttttca tcagccagtc       360
     ccagttccaa agtgttttcc caaaacggct cttagactct atcggctgca ggatcggaag       420
     aactggaacc atttgaagac actgctcaag cattacaacc tcgagagagc ggccattcag       480
     ctcgtcgacc gtggtgagct ttacgactcc tccgattcgg atagtgattc cgacacttcg       540
     tcccgttttc actctatcga cagggagctt gatcgggcta ttgagtctaa tccgtttgct       600
     gccatgtgtt cgctgggccg tcatcttggc gtggatacag acgctctcca tgatcggatt       660
     atgcagctcg agtttcaaca gaagaaaggc acagtcgcca aacgccccgc ggaagacgcg       720
     ggaagcgttc ggaagatgat acgcgaattg gttacaggcg cgctgcagcc tggttcgttt       780
     acgagagcag agccgcttct cgatgatgac tctgaaggga aatataccaa actggaatgg       840
     gaggtcgact cagagaagtt caagcgggaa acggctcatc ttcgccttcg tgacaccgag       900
     gtctcacccc gcccagccag cgccaaagac agtccgggaa atcgccaaca gagggatttg       960
     gaggtccgct cacgtcagtc caagggcagt cggtcgccga ccgagaagat gaccacatca      1020
     agcaaccaat cacagggtca ttag                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page