(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE251

ASFUM1_4.PE251       Location/Qualifiers
FT   CDS_pept        join(complement(1034312..1034713),
FT                   complement(1033789..1034261),complement(1033295..1033715),
FT                   complement(1033107..1033220))
FT                   /codon_start=1
FT                   /gene_family="HOG000271513" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16259022"
FT                   /orf_name="AFUA_4G03690"
FT                   /product="Aldehyde dehydrogenase family protein, putative "
FT                   /EC_number="1.2.1.-"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL84518.2"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG439831"
FT                   /db_xref="HOGENOM:HBG752218"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI0000F51A8F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9U5"
FT                   /transl_table=1
FT                   /translation="MANQIRTLSPSTNEVIFEHQGTSLEEARKIAQASYEAFKLYKKIT
FT                   LSERKDIIVKALELIAANIDTLSNELTTQMGRPIAYSAKEIETMRKRADYLLSIAEDSL
FT                   QEHPGQLEKGFRRSVKKEPVGPTLIATAWNYPYLITINTLVPALLAGNTVILRPSPQTP
FT                   LIGERLLSYFTQAGLPPNVLQLIHVGSLDVLDEIVKLPQIKLVSFTGSTAGGVRIREAT
FT                   ARRIVPVNLELGGKDPAYVRADADIPYVAAQIVDGAVFNSGQSCCSIERVYVHADVHDD
FT                   FVAEVQKELQTYKLGDPTDNSTTTGPVISRHAVKTIQSHIDDALSKGAINATPPNESFL
FT                   SVPSQKPQGNYIAPTVLTNVTHDMTVMKDETFGPVLPIMKVSSDEEAVALMNDSEYGLT
FT                   ASVWTRDIARGEELIAEIEAGTVFINRCDYPSPDLAWVGWKNSGLGCTLGPHAFDGFYK
FT                   LKSYHIKEEQA"
     atggccaacc agattcgcac cttgtctccc tccaccaacg aggttatctt cgaacaccag        60
     ggaacctctc tagaagaggc tcgcaagatt gcacaagcct cttatgaagc attcaaatta       120
     tacaagaaga tcactctctc tgagcgcaaa gatattatcg tcaaagccct cgaattgatc       180
     gcggccaaca tcgacaccct aagcaatgag ctcaccacgc aaatgggccg tccgattgcc       240
     tacagcgcaa aagagatcga gaccatgcgc aaacgcgccg attatctctt gtcaatcgcg       300
     gaggatagcc tgcaggaaca cccaggacag ctagagaagg gatttagacg cagcgtgaag       360
     aaggaaccag ttggaccgac attgatcgcg acagcgtgga attaccccta cctcattacg       420
     atcaacacgc tcgttccagc cctcctggcc ggaaacacgg tcatcctccg tccctccccg       480
     caaacccccc tcatcggcga acgcctcctc tcatacttca cccaagccgg tctgccgccc       540
     aacgtcctcc aactcatcca cgttggctcc ctggacgtcc tcgacgagat cgtcaagctc       600
     ccccaaatca agcttgtctc gttcaccggc tccacagcag gcggcgtccg catccgtgaa       660
     gcgactgccc gccgcattgt cccagtgaac ctcgaactag ggggcaagga tccggcgtac       720
     gtgcgcgccg acgcagacat cccctacgtc gcggcgcaga tcgtcgatgg cgcggtcttc       780
     aactcggggc agagctgctg ctccatcgaa cgggtatatg tccacgcgga cgtccacgat       840
     gattttgtcg cggaggtgca gaaggagctt cagacgtaca aacttggcga tccaaccgac       900
     aactccacaa ccaccggccc cgtcatttcc cgccacgcag tgaaaactat ccagtcgcac       960
     atcgacgacg cactctccaa gggggccatc aacgcaactc cccccaatga atccttcctt      1020
     tctgtcccct ctcagaaacc ccaggggaac tacatcgccc ccactgtgct cacgaacgtc      1080
     acgcacgaca tgaccgtcat gaaagacgag accttcggcc ccgtgctccc catcatgaag      1140
     gtctccagtg acgaggaggc ggttgcgctc atgaacgata gcgagtacgg gctgactgct      1200
     agcgtgtgga cgagggatat cgcgcgcgga gaggagttga tcgctgagat tgaggccggg      1260
     acggtgttca tcaatcggtg tgactatcct agtccggatc ttgcgtgggt tgggtggaag      1320
     aactctggtt tgggatgcac gctgggtccg catgcgtttg atgggttcta taaactgaag      1380
     agctatcata tcaaggagga gcaggcttag                                       1410
//

If you have problems or comments...

PBIL Back to PBIL home page