(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE263

ASFUM1_4.PE263       Location/Qualifiers
FT   CDS_pept        join(1066207..1066395,1066456..1067109,1067171..1067368)
FT                   /codon_start=1
FT                   /gene_family="HOG000170975" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16259026"
FT                   /orf_name="AFUA_4G03810"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84530.1"
FT                   /db_xref="HOGENOM:HBG054407"
FT                   /db_xref="HOGENOM:HBG327367"
FT                   /db_xref="InterPro:IPR021627"
FT                   /db_xref="UniParc:UPI000051FB30"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9T3"
FT                   /transl_table=1
FT                   /translation="MASISKPSSQPPATGVIVPKMEHPPQTTTPAEVPERDNLSGEAWT
FT                   SEMQYVSSLAKLQKMEATIHQLRTLLSGRLIEPIIPIINPKVASRRPLPKSPRVLFEQL
FT                   SQTARASVAEVQEFQAMWRSPEMKAIWDHVDARIKQNGGQLLQPTGMWEQDYDVLLEEL
FT                   EKEEQAQKEQQQRAKEEEERAKIQGVEGGWRTIVETFTRRNLPGIRVMAHQDQPRITVV
FT                   SVKAGMAFQLQAVNGDGHDMVDWRVQELAAPGRPKTKLETAVAACLNARPRQWDLAYLL
FT                   DMIASYSDVKQTPCVKCGKMTDNAAQLPSVRRPNPLQSSQGQPVLWEAYHPTCIDPPPS
FT                   SRPTFS"
     atggcctcta tttcaaaacc cagttcacaa cccccagcga caggcgtcat tgtccctaaa        60
     atggagcatc ctccccaaac tacaaccccc gccgaagtcc ctgagaggga caatttgagc       120
     ggtgaagcct ggacctcaga gatgcagtat gtgtcgtcac tggcgaagtt gcagaagatg       180
     gaggcgacga ttcaccaact acggactcta ctctctgggc gtctcataga gccaataatc       240
     cccatcatca accccaaggt ggcttcgagg aggccactgc caaagtcacc gcgtgtgctc       300
     tttgaacagc tctcgcagac ggcacgcgcg agcgtcgcag aggtccagga gttccaggct       360
     atgtggcgca gccctgagat gaaagccatc tgggaccatg tggatgcgcg gatcaagcag       420
     aatgggggcc agctgctcca gccgacgggg atgtgggagc aggactacga tgttcttctt       480
     gaggaacttg agaaggagga acaggcgcaa aaggagcagc agcagagggc taaagaggag       540
     gaggaacgcg ccaagattca aggggttgag ggcggctgga ggacgatcgt ggagacgttc       600
     actcgacgaa atctaccagg tattcgggtg atggctcacc aggaccagcc caggatcact       660
     gttgtttcgg tcaaggctgg catggcattt caactgcagg ctgtcaatgg agatggacat       720
     gatatggtcg attggcgggt tcaggaactg gcggctcctg ggaggccgaa gacaaagctg       780
     gaaacggcgg ttgcagcttg tctgaatgct cgtccgcggc aatgggatct tgcatatcta       840
     ctggacatga tagcctccta ctccgacgtc aaacagacgc cgtgcgtgaa atgcggcaaa       900
     atgaccgaca acgccgcgca actgccctcc gtccgcaggc ccaaccccct ccaatcgtcc       960
     caaggccaac cagtcctctg ggaagcatac caccccacct gcatcgatcc tcccccgtcc      1020
     tctcgcccta ccttcagcta a                                                1041
//

If you have problems or comments...

PBIL Back to PBIL home page